Museum

Home

Lab Overview

Retrotechnology Articles

⇒ Online Manual

Media Vault

Software Library

Restoration Projects

Artifacts Sought

Related Articles

Errors

AAA

ABEND

ABENDD

ABENDT

ABFNAM

ABKEYW

ABKW

ABNORMAL_EXIT

ABORT

ABORTC

ABPRIKW

ABSENT

ABSTIMREQ

ABSYMD

ABVERB

ACC

ACCADDCOM

ACCCIR

ACCDISERR

ACCERR

ACCESSFAIL

ACCLIN

ACCONFLICT

ACCOUNT

ACCQUOTA

ACCVIO

AC_LSS_MP

ACPMBFAIL

ACPNAME

ACPRECURS

ACPSHO

ACPTIME

ACPUNSTAK

ACPVAFAIL

ACPVAFUL

ACS

ACSIGN

ACT

ACTIVE

ACTIVEBCB

ACVINORCV

ADDERR

ADDFIL

ADDFILE

ADDMSG

ADDQUOTA

ADDRANCOV

ADJSCROLLREG

ADRLSTSYNX

ADRWRTDAT

ADVADVCOMP

ADVADVERSEND

ADVALLOC

ADVBADFORMAT

ADVBTIM

ADVCACHEINIT

ADVCANTIM

ADVCHUID

ADVCLILOADFAIL

ADVDEASGN

ADVDEFCONN

ADVDEFLOAD

ADVDEFOPEN

ADVDEFPARSE

ADVDEVCHECK

ADVDUMPFAIL

ADVETHERMEM

ADVMBX

ADVNICKUID

ADVPRIV

ADVRANDOM

ADVRECBUF

ADVRECREATE

ADVREREAD

ADVSETIMR

ADVSOLCOMP

ADVTIMERR

ADVUIDNICK

ADVWRITETHER

AGAIN

AID

ALCPHD

ALCSMBCLR

ALI

ALIGNDISK

ALIGNXCEED

ALLOC

ALLOCCLR

ALLOCEXT

ALLOCFAIL

ALLOCMEM

ALLOCSET

ALN

ALPBFOVF

ALQ

ALRCURTID

ALREDEF

ALTIHDBAD

AMBCMD

AMBDATTIM

AMBIG

AMBIGNAME

AMBIGSYMUSED

AMBKEY

AMBSYMDEF

ANI

AOP

APPENDEDB

APTREFHIGH

APTWRTERR

AQBTIME

ARCHIVEDSB

ARCHIVEMOVE

ARCHIVENEW

ARCNOTDISK

ARCOPENFAIL

ARGMISMATCH

ARGREQ

ARGTOOLONG

ARTRES

ASCEFCFER

ASCTOOLONG

ASGNMNTSYN

ASGNQUE

ASSIGN

ASSIGNFAIL

ASTFLT

ASTRPDFER

ASYNCACTIVE

ASYNCWRTER

ATLINE

ATPC

ATPROCLINE

ATR

ATTACHED

ATTCONSTO

ATTREQREF

ATW

AUTOMEMCOPY

AUTOMEMERGE

AUTOMEMSUCC

AUTOSYNC

BACKLINK

BACKUPERR

BADACC

BADACP

BADACTRL

BADALORQSZ

BADARGS

BADASSIGN

BADATTRIB

BADBITMAP

BADBLK

BADBLKSIZE

BADBLOADR

BADBLOCK

BADBLOCKS

BADBLOSIZ

BADBOOTCB

BADBUFADR

BADBUFTYP

BADBUFWRITE

BADBUG

BADBYTE

BADCACHE

BADCASE

BADCASELIMIT

BADCASERANGE

BADCCC

BADCHAR

BADCHKSUM

BADCONDEV

BADCOPIES

BADCSP

BADCTLMSK

BADDALRQSZ

BADDATA

BADDATCHK

BADDATDAT

BADDATLEN

BADDELETE

BADDELIM

BADDENS

BADDEV

BADDIR

BADDIRENT

BADDISDEV

BADDISDIR

BADDST

BADDSTMAP

BADDSTVBN

BADECO

BADEFBLK

BADENTRY

BADESCAPE

BADEVTYP

BADEVVAL

BADEXCL

BADEXCLNAM

BADEXE

BADEXECLO

BADEXERAB

BADEXH

BADEXITIF

BADFID

BADFIELD

BADFILE

BADFILEHDR

BADFILENAME

BADFILEVER

BADFIRSTLINE

BAD_FIXUPVEC

BADFLAG

BADFORKIPL

BADFORM

BADFRAME

BADFRMT

BADFUNC

BADGETDIR

BADGSD

BADHDR

BADHEADER

BADHIBLK

BADHOMBLK

BADIDENT

BADIF

BADIMGHDR

BADINDEX

BADINITSZ

BADIONAME

BADIRECTORY

BADISD

BADJOBID

BADJOBNAME

BADJOUCHAR

BADJOUCOM

BADJOUCPOS

BADJOUEDIT

BADJOUEIGHT

BADJOUFILE

BADJOUINIT

BADJOUINPUT

BADJOUKEY

BADJOULINE

BADJOULPOS

BADJOUPAGE

BADJOUSEC

BADJOUSTR

BADJOUTERM

BADJOUWIDTH

BADJRNL

BADKEY

BAD_KEY

BADLABELQ

BADLCKWSLE

BADLEXARG

BADLEXFORM

BADLOGIC

BADLOGICPC

BADLONG

BAD_LRL

BADMARGINS

BADMATCH

BADMCKCOD

BADMODE

BADMODNAM

BADMOPFCT

BADMOPPGM

BADMOPPROC

BADMOPSID

BADMOPVER

BADMSG

BADNODFORM

BADOFFSET

BADOPCODE

BADOPEN

BAD_ORDER

BADOUTBAND

BADOVR

BADPAD

BADPAGFILA

BADPAGFILD

BADPAGTYPE

BADPARAM

BADPARSETBL

BADPAT

BADPKT

BADPNAME

BADPRO

BADPROC

BADPROCNAME

BADPROG

BADPROGDELETE

BADPROMPTLEN

BADPRTY

BADPSC

BADQFILE

BADQHDR

BADQNAME

BADQUAL

BADQUEUEHDR

BADRANGE

BADRCT

BADREAD

BADREFCNT

BADREPLY

BADREQUEST

BADRETURN

BADRSEIPL

BADRVNWCB

BADSBMBLK

BADSCOPE

BADSECTION

BADSEQNUM

BADSETAFF

BADSETCNT

BADSIGARG

BADSORT

BADSPC

BADSPEC

BADSPLINDEX

BADSPLNAME

BAD_SRL

BADSTA

BADSTACK

BADSTART

BADSTARTPC

BADSTATUS

BADSTRCNT

BADSTRLVL

BADSTRUCT

BADSUBFCN

BADSWPVBN

BADSYM

BADSYMTAB

BADTAGVAL

BADTARGET

BADTIME

BADTYPE

BAD_TYPE

BADUIC

BADUSERDESC

BADUSR

BADUSRDAT

BADUSRLEN

BADVALUE

BADVEC

BADVOL1

BADVOLACC

BADVOLLBL

BADWATCH

BADWCBPT

BADWIDTHCHANGE

BADWINDADJUST

BADWINDLEN

BADWORD

BADZONE

BASDUERRS

BASESYM

BASSHRBEL

BATCHNOOPR

BATIS_OFF

BATIS_ON

BATSTIPRO

BBFOVF

BBFWRT

BBLHEADER

BDPPURGERR

BEGIN

BEGIND

BEGINT

BEGNLEND

BEGOFBUF

BEGOFFILE

BEGRAN

BES

BINARYOPER

BINCHKSUM

BINRECFMT

BITMAPERR

BITMAPINV

BITRANGE

BKS

BKZ

BLK0BAD

BLKDIRSYNX

BLKEXPNABS

BLKZERO

BLN

BLOCKCHECK

BLOCKCHECK0

BLOCKCNTERR

BLOCKCRC

BLOCKLOST

BLPRSP

BMS

BOF

BOTLINETRUNC

BRDCST

BRDESTRANG

BRDMSGLOST

BREAK

BRKNLIB

BRTOOFAR

BUFBLKREQ

BUFBYTALI

BUFFEROVF

BUFFERSLOST

BUFNOTALIGN

BUFOVF

BUFOVFL

BUFOVR

BUG

BUGCHECK

BUG_DAP

BUG_DDI

BUSY

BVN

CACLS

CAFINVGROUP

CAFNEITHER

CAFNOTCLU

CAFOLDGROUP

CAFOLDPASS

CAFPASSLEN

CAFREBOOT

CALLOVER

CALLUSERFAIL

CANCEL

CANCELED

CANCELQUIT

CANNOTUNSEL

CANT_BIND

CANTACCESSMAIN

CANTBAL

CANTEXPREG

CANTGETFID

CANTLOCK

CANTLOCMAC

CAPTINT

CAPTINQ

CAPTIVE

CARDS

CASETOOLARGE

CBT

CCF

CCR

CDA

CEBREFNEG

CEM

CENTRL

CHAINW

CHAN

CHANGE_INV

CHG

CHK

CHKALTHOME

CHKPRIHOME

CHKSCB

CHMONIS

CHMVEC

CHN

CINBAD

CINREJ

CIPORT

CIREXLST

CJFERR

CJL

CLASDISAB

CLASMISS

CLASNP

CLASUNK

CLIERR

CLIFAIL

CLIFRCEXT

CLIMISMATCH

CLIPBOARDFAIL

CLIPBOARDLOCKED

CLIPBOARDNODATA

CLIPBOARDZERO

CLIPROT

CLIQUAL

CLISYMTBL

CLIWARNMSG

CLOSEDEL

CLOSEERR

CLOSEFILE

CLOSEFOREIGN

CLOSEIN

CLOSEJOB

CLOSEMON

CLOSEOUT

CLREFCFER

CLSERR

CLSTBLERR

CLUBELBAS

CLUEXIT

CLUGDIFF

CLULIST

CLUPDIFF

CLUSTER

CMDCAN

CMDERR

CMDINPUT

CMDLIN

CMDNOTFND

CMDNOTVLD

CMDOBS

CMDSYNTAX

CMDTOOLONG

CMODSUPR

CMODUSER

CMPOUTF11

CNF

CNFOVR

CNFQUAVAL

CNS

CNTERR

CNTRLY

CNVRTING

CNXMGRERR

COB

COD

COF

COI

COLLERR

COMBCLU

COMCOD

COMFAIL

COMFIL

COMFILEMTY

COMMA

COMMHARD

COMOREXE

COMPARED

COMPAT

COMPBEGIN

COMPEND

COMPFAIL

COMPILED

COMPILEFAIL

COMPLETE

COMPLX

COMPSYNC

COMREMJBC

COMSTA

CONABORT

CONCAT

CONCEALED

CONERR

CONFATTR

CONFBASADR

CONFCON

CONFDEFREQ

CONFDEL

CONFDIS

CONFFAC

CONFIXMEM

CONFLICT

CONFMEM

CONFNEG

CONFNOCON

CONFNODIS

CONFNONNEG

CONFNOPARM

CONFNOQUAL

CONFOUTPUTS

CONFPARM

CONFQUAL

CONFROUTIMG

CONNEC

CONNECFAIL

CONSEQERR

CONSTRTOOLARGE

CONTINUE

CONTINUED

CONTRACT

CONTRADEF

CONTROLC

CONTROLO

CONTROLY

CONVERT_STALL

COO

COPIED

COPIEDB

COPIEDC

COPIEDR

COPMSG

COPY_LOG

COPY_LOG_ENDED

COPY_LOG_LINE

COR

CORRUPTEMB

CPUCEASED

CPUEXIT

CPUNOTACT

CPUNOTVLD

CPUSANITY

CPUSPINWAIT

CPUSTARTD

CPUSTARTIP

CPUSTOPPING

CRC

CRCLS

CRE

CREA_ERR

CREATDIR

CREATE

CREATED

CREATED_SOME

CREATEDSTM

CREATEFAIL

CREATELOST

CREATEVIRT

CREDIR

CREDIRERR

CREERR

CREJOB

CRENEWFOLD

CREPARFIL

CREPRC

CREPRCFAL

CREPRIJOB

CREQUE

CRE_STM

CRF

CRFERR

CRMP

CRMPSC

CRP

CTRLCEXIT

CTRLCHAR

CTRLCJOU

CTRLERR

CTRLY

CTXSTSERR

CUR

CUREXEC

CVTERR

CVTUNGRANT

CWF

DAC

DAN

DATACHECK

DATADEVERR

DATAER

DATALSTSYN

DATAOVERUN

DATAOVFL

DATATRUNC

DATFILCRE

DATMISMCH

DATTOOLNG

DBCORRUPT

DBGERR

DBGTFR

DBLERR

DCVNOTFND

DDIFIN

DDIFOUT

DEADLOCK

DEBUG

DECNET

DECOVF

DECPTREF

DECTSTFAI

DEFAULTED

DEFAULTLEN

DEFCHARSTIC

DEFERR

DEFFORM

DEFFORUSE

DEFKEY

DEFOVF

DEFPWD

DEL

DELACCESS

DELCONPFN

DELDATERR

DELETE

DELETED

DELETEFAIL

DELETESWL

DELEXIGBL

DELGBLSEC

DELGBLWCB

DELHEADER

DELHEADER_BUSY

DELKEY

DELKEYERR

DELSYM

DELTIMREQ

DELTVA

DELVER

DELWSLEX

DENOSU

DENSITY

DEQSUBLCKS

DESSTROVF

DESTP

DEUNUS

DEV

DEVACTIVE

DEVALLOC

DEVALRALLOC

DEVALSPL

DEVASSIGN

DEVCLASS

DEVCMDERR

DEVCOUNT

DEVFOREIGN

DEVICE

DEVICEFULL

DEVICES

DEVINACT

DEVMNT

DEVMOUNT

DEVNOTALLOC

DEVNOTBLK

DEVNOTERM

DEVNOTEXIST

DEVNOTFOR

DEVNOTKNWN

DEVNOTMBX

DEVNOTMOUNT

DEVNOTSPL

DEVNOTSUIT

DEVOFFLINE

DEVOFFLINX

DEVONLINE

DEVONLY

DEVQUALS

DEVRCT

DEVREQERR

DEVSELREQ

DEVSPEC

DEVWRTLCK

DFL

DGQINCOMP

DIAGNOSTIC

DIAGPACK

DIALFAI

DIALINNOT

DIFACCTS

DIFCHARS

DIFLWDS

DIFSTRINGS

DIFTIMES

DIFTYP

DIFVAL

DIR

DIRALLOC

DIRECT

DIRE_ERROR

DIRENTRY

DIRFULL

DIRNAME

DIRNOTCRE

DIRNOTEMPTY

DIRSYNX

DISCON

DISCONNECT

DISKCLASS

DISKFRAG

DISKS

DISMAL

DISMOUNTD

DISMPART

DISPCHARSTIC

DISPERR

DISPFILE

DISPFORM

DISPJOB

DISPLAY_SHORT

DISPQUE

DISREQ

DIVBY_ZER

DIVBYZERO

DIVZERO

DNA

DNF

DNR

DNS

DOESNTFIT

DONEMSG

DOS11_BADLABEL

DOS11_BLOCKSIZE

DOS11_IOERROR

DOS11_POSITION

DOUBLDALOC

DOUBLDEALO

DPE

DQCLUS

DRIVENAM

DRVERR

DRVRSTRT

DSAQUOTA

DSTNESDEP

DTP

DTRBADMAIL

DTSBADMAIL

DUALLOC

DUMPEMPTY

DUMPERRORS

DUMPINCOMPL

DUP

DUPBLKNUM

DUPBUFNAME

DUPCOMFIL

DUPDEF

DUPDEVSPC

DUPDSKQUOTA

DUPFILENAME

DUPFORM

DUPGLOBAL

DUPIDENT

DUPINVALID

DUPKEY

DUPKEYMAP

DUPKEYMAPLIST

DUPLABEL

DUPLNAM

DUPMOD

DUPMODULE

DUPMSG

DUP_OUTPUT

DUPPLACE

DUPPREFIX

DUPPROMPT

DUPQUAL

DUPRVN

DUPSYM

DUPSYNTAX

DUPTYPE

DUPUNIT

DUPVALUE

DUPVOLNAM

DVI

DVN

DX1

DX2

ECONOTSET

ECOSET

EDITPROC

EDITSCLSH

EDOUTSEQ

EF_ALRFRE

EF_ALRRES

EFD

EF_RESSYS

ELD

ELEALREXI

ELETOOLON

EMPTY_CHECK

EMPTYDEF

EMPTYFILE

EMPTYHIST

EMPTYIN

EMPTYJOB

EMPTYKMLIST

EMPTYLIBRARY

EMPTYLST

EMSKNOTABS

ENAQUOTA

END

ENDABORT

ENDDIAGS

ENDED

ENDEDD

ENDEDT

ENDNOOBJ

ENDOFBUF

ENDOFFILE

ENDOFTAPE

ENDOFVOLUME

ENDPRS

ENDTOPIC

ENDWRNGMAC

ENGLUSED

ENQ

ENT

ENTERED

ENTERLOST

ENTERR

ENTFIL

ENTIDMTCH

ENTIDMTCHB

ENTIDMTCHO

ENTIDMTCHT

ENTNF

ENV

ENVNOTSET

EOF

EOFMISMATCH

EOMERROR

EOMFATAL

EOMFTL

EOMSTK

EOMWARN

EOTIN

EQV_NOTICE

ERACTED

ERASEBLKS

ERASEFAIL

ERBOXPROC

ERRASSIGN

ERRAT_LIN

ERRCACHFUL

ERRCLSFILE

ERRCRELNM

ERRCVTFIL

ERRCVTOPN

ERRDEASSIGN

ERREXECOM

ERREXEFIL

ERREXEOPN

ERREXEREA

ERREXEREP

ERRFAO

ERRFREDYN

ERRGETDVI

ERRGETEF

ERRHALT

ERRINPFIL

ERRINVEDIT

ERRLIN

ERROR

ERROR_HALT

ERRORISUE

ERRORS

ERROUTOPN

ERRPARSE

ERRPHOTRA

ERRPROMPT

ERRQIOW

ERRRECFIL

ERRROUCAL

ERRSMG

ERRSYMACTIVE

ERRSYSINFO

ERRSYSSERV

ERRTSTMOD

ESA

ESCAPE

ESL

ESS

ESTABCON

EVENT_OCCURRED

EVL

EVTSIZ

EXARANGE

EXASTLM

EXBIOLM

EXBYTLM

EXCDURCAL

EXCPSC

EXCPTSTER

EXCPUTIM

EXDEPTH

EXDIOLM

EXDISKQUOTA

EXEABO

EXECUTEFAIL

EXECUTING

EXENQLM

EXFILLM

EXGBLPAGFIL

EXHFUL

EXHNEVCAL

EXISTS

EXITFAIL

EXITING

EXITSTATUS

EXLNMQUOTA

EXP

EXPAGQUO

EXPANDPHD

EXPCOMPLEX

EXPECTED

EXPGFLQUOTA

EXPIRED

EXPORTQUOTA

EXPOVR32

EXPRCLM

EXPREG

EXPSHRPAT

EXPSTKOVR

EXPSYN

EXPTOOCOM

EXPVIR

EXQUOTA

EXT

EXTBIT

EXTCACHIV

EXTEND

EXTENDED

EXT_ERR

EXTN_ERR

EXTNOTFOU

EXTNOTFOUND

EXTQELM

EXTRACTED

EXTRAENDM

EXTRANEOUSARGS

EXTRAPARM

FAB

FAC

FACOVFL

FACTBAD

FACTOOLONG

FAIL

FAILED

FAILFREVM

FAILGETVM

FAILURE

FAILURE_STATUS

FAIOPEFIL

FAO

FAOBUG

FAOFAIL

FATALERR

FATALERROR

FATALEXC

FATALEXCPT

FATERRLIB

FATINTERR

FAU

FCPREADERR

FCPREPSTN

FCPREWNDERR

FCPSPACERR

FCPWRITERR

FDEXNORCV

FDLERROR

FDLPAR

FDLPARSE

FEL

FEX

FFVSDIVER

FFVSMLTER

FFVSSBTER

FFVVADDER

FFVVDIVER

FFVVMLTER

FFVVSBTER

FIDERROR

FIDNOTFND

FIDNUM_ZERO

FIELDLIM

FIL11_NOREC

FILACCERR

FILADDED

FILALRACC

FILAREDIF

FILCNTNONZ

FILDISABL

FILE_ABSENT

FILE_EMPTY

FILE_EXISTS

FILEACC

FILECONVERTED

FILEGONE

FILEIN

FILEIO

FILELOCKED

FILEMPTY

FILENABL

FILENOTFOUND

FILENUMCHK

FILEOUT

FILEPURGED

FILESEQCHK

FILESTRUCT

FILETOOLONG

FILLIM

FILMODIFD

FILNOPOST

FILNOTACC

FILNOTCNTG

FILNOTDEL

FILNOTEXP

FILNOTFND

FILNOTPUR

FILOPE

FILPURGED

FILREMOVED

FILREQD

FILTOOLON

FILTRNERR

FINDHOME

FINDIHD

FINISHED

FIRSTMOD

FLAGTRUNC

FLG

FLK

FLOOVEMAT

FLOUNDMAT

FLOVNORCV

FLTDIV

FLTDIV_F

FLTOVF

FLTOVF_F

FLTPNTSYNX

FLTUND

FLTUND_F

FLUNNORCV

FLUSH

FNA

FND

FNF

FNM

FOP

FORCEDERROR

FORCEDEXIT

FORGET

FORM_ABORT

FORMAT

FORWLOOP

FPART_SECTN

FREEBADBUF

FREEMEM

FREEPAGREF

FREEVM

FRERANGE

FRESIZE

FREWSLX

FROMBUILTIN

FROMLINE

FROMPROCLINE

FRZNCTX

FSZ

FTM

FUL

FUNNOTSUP

FUTBAKDAT

FUTCREDAT

FUTREVDAT

FWF

GBC

GBLNDF

GBLNOTCRE

GBLONLY

GBLPAGSZRO

GBLSECMAP

GBLSELOWNER

GBLWARN

GBLWSLXERR

GENERR

GEN_MAX

GENMINUS1

GENWRN

GETCHN

GETDVI

GETERR

GETJPI

GETJPIERR

GETMEM

GETMSG

GETPTIERR

GETTIM

GETVM

GFC

GFVSADDER

GFVSDIVER

GFVSMLTER

GFVSSBTER

GFVVADDER

GFVVDIVER

GFVVMLTER

GFVVSBTER

GOSUBMAX

GPGNULPGFL

GPTFULL

GRANTERR

GRANTMSG

GSDFULL

GSDTYP

HALT

HALTED

HANGUP

HBREAD

HBWRITE

HDRBLK

HDRCRC

HDRERRS

HDRNOTMAP

HDRNOTRES

HDRTRUNC

HEADCOPIED

HEADER_DEL

HEADERFULL

HELP

HELPERR

HIB

HIBER

HIDDEN

HIGHVER

HISTERR

HOMBLKBAD

HOMBLKCHK

HRDFAI

IAL

IAN

IBF

IBK

IBO

ICONCLUDAT

ICONPFNDAT

ICPAGELOC

ICVNOTFND

IDD

IDENT

IDMISMATCH

IDMISMCH

IDOUTRNG

IDR

IDX

IDXCONCAT

IDXFILEFULL

IDXHDRBAD

IDX_LIM

IDXMAPERR

IFA

IFDIRSYNX

IFEXPRNABS

IFF

IFI

IFL

IFLEVLXCED

IFREPAGCNT

IFT

IGNCLIFLAG

IGNFIL

IGNORED

IGNORE_DIRE

IGNORE_VERS

IGNQUAL

IIF

ILC

ILE

ILLANSIBS

ILL_ARG

ILLARGDESC

ILLASCARG

ILLBATFNC

ILLBLKNUM

ILLBRDEST

ILLCDTST

ILLCHR

ILLCNTRFUNC

ILLCOMPONENT

ILLCREOPT

ILLCTL

ILLDESQUE

ILLDFLTARG

ILLEFC

ILLEGALTYPE

ILLEVTNUM

ILLEXPR

ILLFMLCN

ILLFMLCNT

ILLFMT

ILLFORMAT

ILLFUNC

ILLIDXNUM

ILLIFCOND

ILLINDXREG

ILLINISTR

ILLINROU

ILLIOFUNC

ILL_KEY

ILLKEYLVL

ILLMACARGN

ILLMACNAM

ILLMASKBIT

ILLMODE

ILLMODNAM

ILLMTCOPY

ILLNAMELEN

ILLOP

ILLOPDEF

ILLOPDEFVL

ILLOPT

ILLOUTROU

ILLPAGCNT

ILLPATAS

ILLPSCLEN

ILLQUAL

ILLQUALVAL

ILLRECLEN

ILLRECLN2

ILLRECTY2

ILLRECTYP

ILLREGHERE

ILLREGNUM

ILLREQUEST

ILLRQST

ILLSAVESET

ILLSELF

ILLSEQOP

ILLSER

ILLSEVERITY

ILLSHROPR

ILLSHRXPR

ILLSIGEXT

ILLSTRCLA

ILLSTROPS

ILLSTRSPE

ILLSYMLEN

ILLTIR

ILLTYP

ILLTYPE

ILLVAL

ILL_VALUE

ILLVEC

ILLVECOP

ILLVPS

IMAGEFMT

IMAGEFNF

IMAGELEN

IMAGE_NOT_FOUND

IMGADDED

IMGBASED

IMGDUPINV

IMGFILGON

IMGFILSPE

IMGHDR

IMGINV

IMGNAME

IMGNOTFND

IMGRECSIZ

IMGREMOVED

IMG_SIZ

IMGTRACED

IMGVEXC

IMX

IN_BARRIER_WAIT

INBUILTIN

INCBADDIR

INCCTXT

INCDATTIM

INCDELERR

INCDELETE

INCDEVLIS

INCDSTNES

INCDSTQUE

INCDUMPFORM

INCENTERR

INCFILATR

INCFILSPE

INCFORMPAR

INCHMK

INCKWDCOM

INCMEMNAM

INCMVE

INCOMPACP

INCOMPAT

INCOMPEXI

INCOMPL

INCOMPLETE

INCOMPSHR

INCONISD

INCONQUALS

INCONSDEV

INCONSTATE

INCPTREF

INCQUETYP

INCQUOTA

INCRVN

INCSEGTRA

INCSETCNT

INCVOLLABEL

INDEX

INDEXERR

INDEXOVFL

INDEXTYPE

IND_OVR

INHCHME

INI

INIACC

INIERR

INITERR

INITIAL

INITPRS

INM

INOVNORCV

INPBUFOVR

INPCONERR

INP_FILES

INPSTRTRU

INPTOOLON

INPUT

INPUT_CANCELED

INPUTERR

INSCLIMEM

INSCOLL

INSDFAIL

INSEF

INSERTED

INSERTERR

INSFAIL

INSFANL

INSFARG

INSFBUFDP

INSFCDT

INSFMAPREG

INSFMEM

INSFPRM

INSFRAME

INSFSPTS

INSFVM

INSFWSL

INSKIPPED

INSLUN

INSNFREPAG

INSOPRND

INSQUOCRE

INSSWPFIL

INSUFFMEM

INSUFPAT

INSVIRMEM

INSWAPERR

INTDATCOR

INTDELPRC

INTDIV

INTEGER

INTERLOCK

INTERNAL

INTERR

INTHCHAR

INTINVNODE

INTLOGERR

INTMEMERR

INTNODESPACE

INTOVF

INTPATHSTKOV

INTRNLERR

INTSTKOV

INTSTKUN

INTTERMIN

INVACC

INVACCESS

INVACCREC

INVADAP

INVALIGN

INVALQUAL

INVARG

INVARGMAT

INVARGORD

INVARRDSC

INVATTSIZ

INVATTSTR

INVATTVAL

INVBJLEOF

INVBJLSIZ

INVBJLSTR

INVBJLTYP

INVBKT

INVBLK

INVBLKHDR

INVBLKSIZE

INVBLKTYP

INVBLOCK

INVBTIMSP

INVBUFDELETE

INVCALL

INVCCFIL

INVCHA

INVCHAN

INVCHANAM

INVCHANUM

INVCHAR

INVCHDABS

INVCJFIOD

INVCLADSC

INVCLADTY

INVCLIFLAG

INVCLSNM

INVCMD

INVCOL

INVCOLARG

INVCONT

INVCPUID

INVCTX

INVCTXTYP

INVCVT

INVDATA

INVDATIM

INVDEF

INVDEFATT

INVDEFINE

INVDELIM

INVDESC

INVDEV

INVDEVICE

INVDEVTYP

INVDIR

INVDIRNAM

INVDIS_ID

INVDPT

INVDPTINI

INVDSTQUE

INVDSTREC

INVDTYDSC

INVELEID

INVELENAM

INVELETYP

INVETIMSP

INVEVE

INVEXCEPTN

INVEXHLIST

INVEXP

INVEXTBACK

INVEXTFID

INVEXTHDR

INVFAOPARAM

INVFCBDESC

INVFCO

INVFID

INVFILEXT

INVFILSPE

INVFIXDST

INVFLUSHSP

INVFORNAM

INVFORNUM

INVFUNC

INVFUNCOD

INVGBLSELDATA

INVGOSUB

INVHEADER_BUSY

INVHOMBLK

INVIDE

INVIFNEST

INVIMGHDR

INVINPDMN

INVINPFIL

INVINPUT

INVINTSP

INVIOCODE

INVITEM

INVITEMCODE

INVITEMNM

INVITMCOD

INVKBD_ID

INVKEY

INVKEYCHAR

INVKEYNAM

INVKTB_ID

INVLDADR

INVLDRESP

INVLOCKID

INVLOG

INVLOGFIL

INVLOGIN

INVMAP

INVMAR

INVMAXLEN

INVMODE

INVMSG

INVMSGBUF

INVNAM

INVNBDS

INVNUMBER

INVNUMCHI

INVNUMSRC

INVNUMSTR

INVOOB

INVOPCODE

INVOPER

INVOPEZON

INVOPR

INVOPRND

INVOPTION

INVOPTIONS

INVOUTDMN

INVOUTSPE

INVOVERQUOTA

INVPAGARG

INVPARAM

INVPARFIL

INVPARLEN

INVPARM

INVPARVAL

INVPAS_ID

INVPASS

INVPATH

INVPERMQUOTA

INVPGP

INVPLACE

INVPRVNAM

INVPTEFMT

INVPVA

INVPWD

INVPWDLEN

INVQUAL

INVQUAVAL

INVQUENAM

INVQUO

INVRANGE

INVRECFMT

INVRECORD

INVRECSIZ

INVRECTYP

INVREPTYP

INVREQ

INVREQCOD

INVREQPARM

INVREQTYP

INVRFA

INVRFM

INVROUT

INVROW

INVRSP

INVRSPID

INVSCRPOS

INVSEMINI

INVSEMMAX

INVSHDWMEM

INVSMG

INVSPEED

INVSRCLIN

INVSTANAM

INVSTLEVEL

INVSTMNBR

INVSTR

INVSTRDES

INVSTRLEV

INVSTRUCT

INVSYMNAM

INVTAB

INVTABSPEC

INVTERTAB

INVTIME

INVTOKEN

INVTQEFMT

INVTYPE

INVUIC

INVUSER

INVUSERNAME

INVUSERSPEC

INVVAL

INVVALCLAUSE

INVVEC

INVVIEWSP

INVVMSOSC

INVVOI_ID

INVVOLFMT

INVWIDARG

IO_CONCLO

IOERROR

IOP

IRC

ISD_OFF

ISD_SIZ

ISD_VBN

ISI

ISQUAL

ITC

ITD

ITEMNOTFOUND

ITERATION

ITMNOTDEF

IVADDID

IVADDNODE

IVADDR

IVATIME

IVBAKADIO

IVBLKENT

IVBLKNUM

IVBUFLEN

IVCHAN

IVCHAR

IVCHNLSEC

IVCMD

IVDEV

IVDEVNAM

IVDTIME

IVFNAM

IVGBLTYP

IVGSDNAM

IVKEYNAM

IVKEYW

IVLISTK

IVLOCKID

IVLOGNAM

IVLOGTAB

IVLVEC

IVMODE

IVOPER

IVORDER

IVPFAIL

IVPROT

IVPROTECT

IVQLOC

IVQUAL

IVQUOTAL

IVREMID

IVREMNODE

IVS

IVSECFLG

IVSECIDCTL

IVSSRQ

IVSSRVRQST

IVSTSFLG

IVSYMB

IVTIME

IVTYPE

IVVALU

IVVERB

IVWSETLIST

JBCERROR

JBRTAINHLD

JEC

JNLACP

JNLACTIVE

JNLDRV

JNLNOTAUTH

JNLNOTOPEN

JNLOPEN

JNLPUT

JOBABORT

JOBCARD

JOBCTLABORT

JOBDELETE

JOBQUEDIS

JOBQUEENA

JOBREQUEUE

JOURNAL

JOURNALBEG

JOURNALCLOSE

JOURNALEOF

JPITSTERR

KBF

KEY

KEYALRINS

KEYAMBINC

KEYCNV

KEYDEFPRO

KEYED

KEY_LEN

KEYMAPNOTFND

KEYNAMLNG

KEYNOTDEF

KEYNOTFND

KEYNOTFOU

KEYSUPERSEDED

KEYWORDPARAM

KFF

KNM

KRF

KRNLSTAKNV

KSI

KSZ

LABELERR

LAN

LARGECNT

LASTCHANCE

LCKPAGFUL

LDE

LENMUSONE

LENNOTEQL

LENVIO

LEX

LIBFIND

LIBNAMLNG

LIBNOTOPN

LIBOPN

LINCOM

LINEABRT

LINEINFO

LINERR

LINETOOLONG

LINK

LINKABORT

LINKACTIVE

LINKDISCON

LINKEXISTS

LINKEXIT

LINNOTFND

LINPRO

LINTOOLONG

LISINPSAV

LISTENDSB

LISTENENAB

LISTENFAIL

LISTENNOTMBX

LISTNOTFND

LKBGRANTED

LKBREFNEG

LKPNOTDON

LKWSETFUL

LNE

LNK

LOADERR

LOADIDX

LOCKED

LOCKHEADER

LOCKMGRERR

LOCKVOL

LOCNEG

LOCNOTEST

LOCPRES

LOGCLOS

LOGDBUR

LOGDBUT

LOGFAI

LOGFAIL

LOGIC

LOGINIT

LOGNAME

LOGIO

LOGLINK

LOG_IN_USE

LOGOPNM

LOGOPNR

LOGOPNT

LOGTIME

LOGZERNEG

LONGDST

LOOKUPERR

LOSTEXTHDR

LOSTHEADER

LOSTSCAN

LOWQUOTA

LRL_MISS

LSTERR

LSTMSG1

LSTMSG2

LSTTOTBK

LTC

LUNALRFRE

LUNRESSYS

LVSADDER

LVSMLTER

LVSSBTER

LVSSHLER

LVSSHRER

LVVMLTER

LVVSBTER

LVVSHLER

LVVSHRER

MACHINECHK

MACLBFMTER

MACNAMLNG

MAILBOX

MAKEWSLE

MANY_TO_ONE

MAPAREA

MAPCNTZER

MAPHDRBAD

MATCH

MATCHED

MATQUOMIS

MAXBAD

MAXDEV

MAXDIF

MAXLAB

MAXLINKS

MAXMAPPEDBUF

MAXPARM

MAXSERV

MAXTOOBIG

MAXUNITS

MAXVALUE

MAXVOLS

MAYNOTINDX

MBACBHUNG

MBC

MBFULL

MBTOOSML

MBXASGERR

MBXCRERR

MBXCRTERR

MBXRDERR

MBXREDERR

MBXWRTERR

MCHECK

MCHINSTSYN

MCNOTVALID

MDBSFCRUPT

MDBSFRFAI

MDFYERR

MDFYMSG

MEDOFL

MEI

MEMBUG

MEMERRS

MEMFUL

MEMNOTSVD

MERGE

MFN

MFS

MFYNULPGFL

MGTPRM

MHDERR

MINVALUE

MIRBFOVF

MIRCTF

MIRDIS

MISCONFUNI

MISENDSTA

MISFILSPE

MISINVNUM

MISMODBEG

MISMODEND

MISNAMREQ

MISREQPAR

MISSINGEND

MISSINGQUOTE

MISSNGPARM

MISSNGSYM

MISS_PARAM

MISSPASS

MISSQUO

MISSQUOTE

MISSYMTAB

MISTERNAM

MIXEDTYPES

MKD

MLBOPNERR

MNL

MODIFIED

MODIFYERR

MODNAM

MODNAMLNG

MODNOTADD

MODNOTFND

MODOUTAI

MODOUTAIS

MODOUTBI

MODOUTBIS

MODQUOTA

MODRANGEMARKS

MODRELNBAK

MOUNEWVOL

MOUNTDEV

MOUNTED

MOUNTERR

MOUNTERROR

MOUNTF11

MOUNTFOR

MOUSEINV

MOUVOL

MOVEFILES

MOVETOCOPY

MQS

MRC

MRG

MRGGTMTCH

MRN

MRS

MSCPNOTLD

MSCPSERV

MSGBUFSET

MSGCMAIIF

MSGNOTFND

MSGQUEEMPTY

MSTINTERR

MTLBLLONG

MTLBLNONA

MTXCNTNONZ

MULCLUOPT

MULDEF

MULDEFLBL

MULDEFPSC

MULPRI

MULPSC

MULSEC

MULSHRPCS

MULTALLOC

MULTCHNG

MULTECO

MULTEXTHDR

MULTFR

MULTIDEF

MULTIPLENAMES

MULTISELECT

MULTOPR

MULTRMS

MUSTBECONST

MUSTBEONE

MUSTCLOSEFL

MVABORTED

MVCOMPLETE

NAFADDERR

NAFAEX

NAFCONERR

NAFCREERR

NAFDNE

NAFDONEMSG

NAFNOMODS

NAFUAEERR

NAM

NAMETOOBIG

NAOFIL

NAONAF

NARG

NCBFAIL

NCS

NEEDBOTH

NEEDFILENAME

NEEDMORE

NEEDTERMS

NEEDTOASSIGN

NEF

NEGATED

NEGSHBREF

NEGSTRLEN

NEGTIM

NESTERROR

NESTLEVEL

NET

NETASN

NETDAS

NETDIS

NETERR

NETFAIL

NETIO

NETIOERR

NETLSTMSG

NETMBX

NETNOBUF

NETNOSTATE

NETRCVPKT

NETSYSSRV

NETTRANCNT

NETWORK

NEWCOMPFIL

NEW_FILE

NEWFILES

NEWIGNORE

NEWSERVERDB

NEWPAGE

NEWQUEUE

NEWSAVSET

NEWTAPE

NEXNOTUBA

NEXTVOL

NIA

NIC

NMF

NMLRSP

NO

NOACCESSW

NOACCMAN

NOACCPTMSG

NOACESS

NOACNT

NOACPCHAN

NOACPDEV

NOACPMAIL

NOADAPTER

NOALLOC

NOALLSPOOL

NOALTPRI

NOANGLE

NOANSWER

NOAQB

NOAQBACP

NOARG

NO_ARGS

NOASSIGNMENT

NOAUTOCNF

NOAVAIL

NOBACKUP

NOBADDATA

NOBADINFO

NOBITMAP

NOBRANCH

NOBREAKPOINT

NOBREAKS

NOBUFPCKT

NOBUGCHK

NOBVPVCB

NOBYPASS

NOCACHE

NOCALLS

NOCALLUSER

NOCARRIAGE

NOCCAT

NO_CHADIS

NOCLASS

NOCLASSES

NOCLI

NOCLITABLE

NOCLUDEV

NOCLUSTER

NOCMDMEM

NOCMDPROC

NOCMEXEC

NOCOMMUNICATION

NOCMK

NOCMKRNL

NOCOMD

NOCOMMSTLEV

NOCONNECT

NOCONSOLE

NOCONTIG

NOCONVBOOT

NOCOPBAD

NOCOPBADDEL

NOCOPDUP

NOCOPLOCK

NOCOPNODEL

NOCOPPROT

NOCOPSAMDEV

NOCOPSYSDEL

NOCOPYBOOT

NOCOPYBUF

NOCPUS

NOCSP

NOCURLOC

NOCURRENTBUF

NOCURTID

NOD

NODECODE

NODEDISABLED

NODEENABLED

NODEFINITION

NODEFPWD

NODEINIERR

NODELIMTR

NODELLOCK

NODENOTAVAIL

NODENOTCLU

NODENOTMEM

NODENOTPRES

NODERR

NODESTQUE

NODETACH

NODEVADAP

NODEVAVL

NODEVICE

NODEXIT

NODIAGNOSE

NODIATONE

NODIRLISM

NODIRLIST

NODISKQUOTA

NODSTQUE

NODTOOBIG

NODUPEXC

NOELEM

NOENCODE

NOEND

NOENDOFLINE

NOENTRYSYM

NOCHARREAD

NOEOBSTR

NOEOM

NOEPM

NOEXQUOTA

NOFIELD

NOFILE

NOFILEACCESS

NOFILEID

NOFILEROUTINE

NOFILES

NOFILNAM

NOFILPURG

NOFORCMD

NOFORMLARG

NOFREE

NOGBL

NOGBLSEC

NOGBLSELDATA

NOGBLSELOWNER

NOGLOBALS

NOGROUP

NOGRPNAM

NOGRPWILD

NOGSDREF

NOHANDLER

NOHDJMT

NOHDRRES

NOHIDDEN

NOHISTORY

NOHLPLIBS

NOHLPTXT

NOHOME

NOHOMEBLK

NOIDNAM

NOIMGFIL

NOINDEX

NOINDEXF

NOINIT

NOINPFILES

NOINPTAB

NOINSTRAN

NOINTABLE

NOIOCHAN

NOJOBCTX

NOJOBID

NOJOBNAME

NOJOURNAL

NOKEY

NOKEYMAP

NOKEYMAPLIST

NOKEYW

NOKFEFND

NOLASTVAL

NOLBLS

NOLCL

NOLICENSE

NOLINK

NOLINKS

NOLINXXX

NOLIST

NOLISTENER

NOLITERAL

NOLOAD

NOLOCALS

NOLOCKID

NOLOGNAM

NOLOGTAB

NOLOWVER

NOMACFOUND

NOMALFUN1

NOMALFUN2

NOMATCH

NOMATCHES

NOMATCHFOU

NOMBX

NOMCHKFRAME

NOMEMBER

NOMODNAM

NOMODS

NOMORE

NOMORECHAR

NOMOREENT

NOMOREFILE

NOMOREFILES

NOMOREFORM

NOMOREITEMS

NOMOREJOB

NOMOREKEYS

NOMOREMSG

NOMOREPROC

NOMOREQUE

NO_MORMSG

NOMP

NOMSGS

NOMTCHENDM

NOMTCHENDR

NOMTCHFOU

NOMULTBK

NONAMES

NONANSICRT

NONBRDMSG

NONCONTIG

NONEDEL

NONEFOUND

NONEREC

NONET

NONETMBX

NONEWMAIL

NONEXDRV

NONEXIST

NONEXISTBUF

NONEXPR

NONEXSTACP

NONLOCAL

NONODE

NONPHYSET

NONPIC

NONPICDAT

NONPICIMG

NONPICREF

NONSMPDRV

NONSTDUNI

NONXTLIN

NOONE_ENABLED

NOOPCOM

NOOPENJOB

NOOPER

NOOPR

NOOPRND

NOOUTPUT

NOOUTQUAL

NOP1VA

NOPAGEDYN

NOPARAM

NOPAREN

NOPARENT

NOPARM

NOPASS

NOPASSWORD

NOPATAREA

NOPE

NOPERATOR

NOPFNMAP

NOPRED

NOPREV

NOPRINT

NOPRIV

NOPRIVDIRSUM

NOPRMCEB

NOPRMGBL

NOPRMMBX

NOPROC

NOPROCESS

NOPRODS

NOPROT

NOPSCTS

NOPSWAPM

NOQFILE

NOQUAL

NOQUECTX

NOQUESPACE

NOQUEUE

NOQUOTE

NORCP

NORCVBUF

NOREAD

NOREADCP

NO_RECORD

NOREDEFINE

NOREF

NORELNOTE

NORELOC

NOREMOTE

NORENDEV

NORENEXISTS

NORENLOCK

NOREPAIR

NOREQ

NOREQSYM

NORESTART

NORETURNVALUE

NORIGHTSDB

NORMAL

NORMAL_EXIT

NOROOM

NORSTBLD

NORTTB

NORUNMCR

NOSAVESET

NOSAVPEXC

NOSCOPE

NOSCS

NOSECEX

NOSELECT

NOSENDBUF

NOSERVER

NOSERVERS

NOSETPRV

NOSEVER

NOSHDWMEM

NOSHMBLOCK

NOSHMEM

NOSHMGSD

NOSHOWBUF

NOSHRD

NOSHRIMG

NOSIGNAL

NOSLOT

NOSOLICIT

NOSPACE

NOSRCHSTR

NOSRCLIN

NOSTATS

NOSTRING

NOSTRMEM

NOSUBEXI

NOSUCC

NOSUCHACE

NOSUCHBPT

NOSUCHCHAR

NOSUCHCPU

NOSUCHCTX

NOSUCHDEV

NOSUCHELE

NOSUCHENT

NOSUCHFILE

NOSUCHFORM

NOSUCHJOB

NOSUCHLOC

NOSUCHMEM

NOSUCHMOD

NOSUCHMODU

NOSUCHNAM

NOSUCHNODE

NOSUCHOBJ

NOSUCHPART

NO_SUCH_PARTY

NOSUCHQUE

NOSUCHRM

NOSUCHRQST

NOSUCHRTN

NOSUCHRVN

NOSUCHSEC

NOSUCHSERV

NOSUCHSYM

NOSUCHTID

NOSUCHTPT

NOSUCHUSER

NOSUCHUSR

NOSUCHVERB

NOSUCHWPT

NOSUMM

NOSYMBOL

NOSYMBOLS

NOSYSACT

NOSYSDISK

NOSYSGBL

NOSYSLCK

NOSYSNAM

NOSYSPRV

NOT1STVOL

NOTACLU

NOTALLPRIV

NOTALLSYM

NOTANSI

NOTAPEOP

NOTARRAY

NOTASCII

NOTASSIGN

NOTASTRUCT

NOT_A_TERM

NOT_A_TRM

NOT_AVAILABLE

NOTBKBLOCK

NOTBOOCAP

NOTCLASS

NOTCMPLT

NOTCOM

NOTCOPIED

NOTCOP_RETRY

NOTCREATOR

NOTCTX

NOTCURPC

NOTDDBDDB

NOTDECSTRG

NOTDEFINABLE

NOTDELETED

NOTDIR

NOTDISCON

NOTDISK

NOTDONE

NOTENABOPT

NOTENUFOPR

NOTERM

NOTERMS

NOTERRORKEYWORD

NOTFCBFCB

NOTFCBWCB

NOTFCPWCB

NOTFILEDEV

NOTFOU

NOTFOUND

NOTFR

NOTFROMLAT

NOTGENDEV

NOTHEN

NOTHLPLIB

NOTIDFMT

NOTIDX

NOTIFY

NOTIMGLIB

NOTIMP

NOT_IMPL

NOTIMPLAN

NOTIMPLEMENTED

NOTIMPOPCODE

NOTINANIF

NOTINITED

NOTINMACRO

NOTINPHYS

NOTINSTALL

NOTINTBLSZ

NOTIRPAQB

NOTJOURNAL

NOTLABEL

NOTLABELMT

NOTLEARNING

NOTLGLISOP

NOTLKB

NOTLOADED

NOTLOCKED

NOTMOD

NOTMODIFIABLE

NOTMODIFIED

NOTMOUNTED

NOTMPMBX

NOTMTLMTL

NOTNEG

NOTNETDEV

NOTNUMBER

NOTNUMCAP

NOTOBJLIB

NOTODS2

NOTONSCREEN

NOTORIGSRC

NOTPARAM

NOTPASTED

NOTPATADR

NOTPCB

NOTPRINTED

NOTPSECOPT

NOTPSECT

NOTPTR

NOTQUEUED

NOTQUO

NOTRACES

NOTRAN

NOTREADIN

NOTRELVOL

NOTRENAMED

NOTRES

NOTRMSOUT

NOTRULUCB

NOTRVTVCB

NOTSAMEBUF

NOTSAMEDEV

NOTSAVED

NOTSAVESET

NOTSEQ

NOTSET

NOTSHDWDEV

NOTSHRIMG

NOTSPLADDR

NOTSQDEV

NOTSTARTED

NOTSTOPPED

NOTSTRCAP

NOTSTRUCT1

NOTSYSTEM

NOTUCBIRP

NOTUCBRVT

NOTUCBUCB

NOTUCBWCB

NOTUICFMT

NOTUQPORT

NOT_USABLE

NOTVALID

NOTVALLEN

NOTVCBUCB

NOTVOLSET

NOTVVPVCB

NOTWCBIRP

NOTWCBWCB

NOTYET

NOUNIQUE

NOUNLOAD

NOUPDATE

NOUSERNAME

NOUSERPASS

NOUSERSPEC

NOUSRWCS

NOVALATPC

NOVALPRS

NOVALU

NOVALUE

NOVECTOR

NOVER

NOVIRMEM

NOVOLDATA

NOVOLPRO

NOVOLUMES

NOWATCHES

NOWATTAR

NOWBPT

NOWILD

NO_WINASSOC

NOWINDOW

NOWOPCO

NOWORLD

NO_WRK

NOWRT

NPK

NSADDR

NSF

NTD

NUDFENVS

NUDFLSYMS

NUDFSYMS

NULFIL

NULIDX

NULLFILE

NULLPRI

NULLPRIV

NULLSTRING

NULSAVESET

NUMBER

NUMELEMENTS

NUM_KEY

NUMOPRNDS

NUMTRUNC

NUMVAL

NVROPRFAI

OBJ

OBJLOCKED

OBSSERVERDB

OBTEVT

OCCLUDED

OCVNOTFND

ODS2SAVE

OFFHOOK

OFFLINE

OK_ALK

OK_DEL

OK_DUP

OK_IDX

OK_LIM

OK_NOP

OK_RLK

OK_RNF

OK_RRL

OK_WAT

OLDINSCHK

OLDLIBRARY

OLDMISMCH

OLDPURGE

OLDTAB

OLDVALCHK

ONCOMD

ONDELRECLIST

ONEDELTIM

ONEENTQUE

ONEF11DEV

ONEF11OUT

ONEIMGDEV

ONELEARN

ONEPHYDEV

ONERR

ONESELECT

ONEVAL

ONHOOK

ONLEVL

ONOVF

OPCCUS

OPCDEC

OPEFAI

OPEJBCMBX

OPENBITMAP

OPENDIR

OPENEXC

OPENFDL

OPENFILE

OPENFOREIGN

OPENIN

OPENINDEX

OPENMON

OPENOUT

OPINPROG

OPENQUOTA

OPENUAF

OPENVIRTUAL

OPER1

OPER10

OPER11

OPER12

OPER2

OPER3

OPER4

OPER5

OPER6

OPER7

OPER8

OPER9

OPERABORT

OPERASSIST

OPERFAIL

OPERREQ

OPERSPEC

OPERSTS

OPINCOMPL

OPNERR

OPNOTPERDOS

OPNOTSUP

OPNOTPERF11

OPNSNK

OPRABORT

OPREPL

OPREPLY

OPRNDLNG

OPRNDSYNX

OPRNOTIF

OPRQST

OPRQSTCAN

OPRQSTDON

OPRSNDERR

OPSYNTAX

OPTARGMIS

OPTIGNSHR

OPTIGNSYS

OPTLIN

OPTSYNERR

OPTVALERR

ORDER

ORDER_ERROR

ORG

OSCTOOLON

OUTCMDLNG

OUTCONERR

OUTORDER

OUTPUT

OUTPUTLOST

OUT_RANGE

OUTSIMG

OUTSIMGP

OUTSTRTRU

OUTSWPERR

OVERFLOW

OVERLAPRANGE

OVERLAY

OVERWRITE

OVRALI

OVRDSKQUOTA

OVRFLW

OVRSIZ

PACTOOLONG

PAD

PAGECRIT

PAGEFRAG

PAGEREDERR

PAGEWRTERR

PAGLIMEXC

PAGNTRNVAL

PAGOWNVIO

PAGRDERR

PARENREQ

PARGTMTCH

PARITY

PARMDEL

PARNOTGRANT

PARSE

PARSEERR

PARSEFAIL

PARSEOVER

PARSTKOVR

PARTCOPIED

PARTESCAPE

PARTMAPPED

PARTOOBIG

PART_SECTN

PASALREXI

PATERR

PATHAMBIG

PATHLOST

PATHTLONG

PATHUNDEF

PATHUNRES

PATOVER

PBDIN_USE

PBF

PC1

PC2

PC3

PDQUALERR

PEAKUTIL

PENDING

PERMSYM

PES

PEXFULL

PFMBSY

PFNLISTCNT

PFNREFNZRO

PGFGBLBAD

PGFIPLHI

PGFLOCBAD

PHANOTFND

PHYDEVGEO

PHYFILSPE

PHYSET

PLG

PLV

POOLEXPF

PORTRXERR

POS

POSERROR

POSITERR

POWERFAIL

PRACCREM

PRACREN

PRCREAT

PREDEFREP

PREMATUREEOF

PREMEOF

PREMMSG

PREPARED

PRESENT

PREVDUPACE

PREVINIT

PRIIHDBAD

PRIMIN

PRIMNOSTP

PRIMOUT

PRINT

PRISECMAP

PRIV

PRIVINSTALL

PRMEOF

PRMLEN

PRMLON

PRMMS

PRMNA

PRMRNG

PRO

PROCDONE

PROCESSEND

PROCFILE

PROCGONE

PROC_ID

PROCINDEX

PROCSUPERSEDED

PRODNOTINS

PRODSKIP

PROERR

PROFRANOT

PROGLOST

PROL_WRT

PRONOTCHG

PROTECTED

PROTERR

PROTINSTALL

PROTMIS

PROTOCOL

PROTOOLON

PRTEXT

PRV

PRVNOTFND

PRVNOTUNQ

PRVVIO

PSCALI

PSCNXR

PSECBUFOVF

PSECBUFUND

PSECOPCNFL

PSTFULL

PTELENVIOL

PTRCNT

PURABO

PURGEVER

PURGWSSCN

PUSSTAOVE

PUTERR

PWDINDIC

PWDINHIS

PWDLOCKED

PWDNCH

PWDNOL

PWDNOTDIF

PWDNOTVAL

PWDNOTVER

PWDSYNTAX

PWDWEAK

PWF

QEMPTY

QFACTIVE

QFNOTACT

QIOBFOVF

QIOERR

QST

QUALINV

QUE_CLOSED

QUEFORMAT

QUENOTSTOP

QUERESET

QUEUEMPTY

QUITTING

QUO

QUOTAFAIL

QUOTAFILE

RAB

RAC

RADRMOD

RAT

RAWFMT

RBF

RCTUNRSZR

RDBADDERR

RDBADDERRU

RDBADDERRV

RDBADDMSG

RDBADDMSGU

RDBCREERR

RDBDONEMSG

RDBMDFYERR

RDBMDFYERRU

RDBMDFYMSG

RDBNOMODS

RDBREMERR

RDBREMMSG

RDBREMMSGU

RDDELDATA

RDSNONRES

READABORTED

READATTR

READBAD

READBLOCK

READBMAP

READBOOT

READCHECK

READCHECKREC

READDIR

READERR

READERRREC

READERRS

READEVT

READFILE

READHEADER

READHOME

READIMAP

READIBMAP

READJNLACE

READQUEHEADER

READQUOTA

READSBMAP

READSCB

READYREAD

READYWRITE

READZERO

REAJBCMBX

REALLYQUIT

REALLYRECOVER

REBLDREQ

REBLDWARN

REBOOT

REBUILD

RECGTRBL

RECISDEL

RECLNG

RECORDANS

RECORDSWL

RECOVER

RECOVERABORT

RECOVEREND

RECOVERFAIL

RECPRN

RECTOBIG

RECTOOBIG

RECTOOSML

RECTRUNC

RECTYP

RECURLEARN

REDCACHE

REDEFSYM

REDFLGERR

REENT

REENTER

REENTRANCY

REF

REFCNTNEG

REFERENCED

REFRESH_NEEDED

REFUSED

REGOPSYNX

REGWIDDUP

REJECT

RELCONCAT

RELINK

RELMOVED

REMABO

REMARCEST

REMARCFAIL

REMARCNAVL

REMARCSTS

REMDEF

REMDISABLED

REMENABLED

REMNOTENAB

REMERR

REMMSG

REMOINSF

REMOTE

REMOUVOL

REMOVE

REMOVED

REMRSRC

REMSYS

RENAMED

RENDEF

RENMSG

RENSYS

REPEAT

REPLACED

REPLACEERR

REPLACERR

REPLAYFAIL

REPLAYWARNING

REQDITEMMISS

REQFILMIS

REQKEY

REQPRMABS

REQUEST

REQARGSMISSING

REQUIRESDECW

REQUIRESTERM

RER

RESCRASH

RESCRITICAL

RESDISMISS

RESERR

RESET

RESETQUE

RESIGNAL

RESINFO

RESNOTDISK

RESOKAY

RESOPCODE

RESTARTCOM

RESTORE

RESTOREFAIL

RESTRICT

RESULTOVF

RESUME

RESUMED

RESUMEFAIL

RESUMEWARN

RESWARNING

RETURNED

REVERSECASE

REVOKEERR

REVOKEMSG

REWIND

REX

RFA

RFAERR

RFAPASTEOF

RFLOC

RFM

RHB

RLF

RLK

RLSTMSG

RLSSRVERR

RMALRDCL

RMS

RMSBUG

RMSERROR

RMSFILINI

RMSFILMIS

RMV

RNAME_ABSENT

RNAME_INV

RNAME_LONG

RNAME_ODD

RNF

RNL

ROP

ROPRAND

ROUTREQ

RPCERR

RPL

RPTCNTNABS

RQSTABORT

RQSTCAN

RQSTCMPLTE

RQSTDONE

RQSTPEND

RQSTSTST

RRV

RSA

RSBREFNEG

RSBREFNZRO

RSK

RSL

RSLOVF

RS_LSS_AC

RSS

RST

RSTERR

RSV_ERR

RSZ

RT11_BADDIRECT

RT11_BADFILE

RT11_BIGBADFILE

RT11_DIRSIZE

RT11_ERRLOCK

RT11_EXTRA

RT11_NOEND

RT11_OVERFLOW

RT11_STBLOCK

RT11_TOOMANYBLK

RT11_TOOMANYSEG

RT11_UNKENT

RTB

RTL

RTNERROR

RTOUTEOF

RTPROTECT

RTS

RUCONFLICT

RUF

RVN1NOTMT

RVU

SAMEDEVICE

SAMEFILE

SAVEAMBIGSYM

SAVEERROR

SAVEUNDEFPROC

SAVSETCLU

SAVSETNAM

SBIAERROR

SCANADVANCE

SCANDEADPT

SCBRDERR

SCHDWK

SCRBUFOVF

SCSSYSTEMID

SDBSFFULL

SDBSFRFAIL

SEARCHFAIL

SECINTFAI

SECOUT

SECREFNEG

SECTBLFUL

SECTRESTORED

SECTSAVED

SECTUNDEFPROC

SEG

SELRANGEZERO

SEMALRMAX

SEMANTICS

SEMININON

SENDABORT

SENDERR

SENDFAIL

SEQ

SEQNCE

SEQUENCE

SEQUENCE2

SERVE_ERR

SERVEREXIT

SERVEXISTS

SETIMR

SETKEY

SETLIMIT

SETMAX

SETMIN

SEVINVALD

SHARCONF

SHMGSNOTMAP

SHMNOTCNCT

SHOFIL

SHOIO

SHORTBLOCK

SHORTDUMP

SHOW_ERR

SHOWERR

SHR

SHRCNTNEG

SHRCPYIGN

SHRIDMISMAT

SHRINSYS

SHRPSCLNG

SHRPSCREF

SHRSEPCLU

SHRSYMREF

SHRSYMTRA

SHUT

SHUTDOWN

SIGNO_ARG

SIZ

SIZETRUNC

SKC

SKPDAT

SLOWRESP

SMALLPAGE

SOFTRERRS

SOFTWERRS

SOLCONNECT

SOLOPEN

SOLREADLINE

SOLTIMEOUT

SOLWAITING

SORTALLOCMEM

SOURCELINE

SPAWNED

SPCIVC

SPCIVD

SPCIVF

SPCIVI

SPCIVK

SPCIVP

SPCIVS

SPCIVX

SPCMIS

SPCOVR

SPCSIS

SPDNOTSET

SPECDEV

SPECDIR

SPECIFY

SPECNODE

SPECWILD

SPL

SPLACQERR

SPLRELERR

SPLRSTERR

SPLIPLHIGH

SPLIPLLOW

SPNAMLNG

SPTERRS

SPTFULL

SPTNOTFND

SPWNIO

SQO

SQUALERR

SQUROONEG

SRCLIN

SRCLINNOT

SRCMEM

SRTIWA

SRVALLOAD

SRVMISMATCH

SSCHANGE

SSERROR

SSFAIL

SSR

SSRVEXCEPT

STABLEEXC

STACKDUMP

STACKOVER

STALITUDF

STARTDELETE

STARTED

STARTRECORD

STARTVERIFY

STASMALLMEM

STATENTSVD

STATE_UNK

STATOOLONG

STD

STDISPIC

STEPINTO

STGTRUNC

STILLKEYS

STKOVF

STKOVFLO

STMRECFMT

STNOTAVAIL

STOPPED

STPCLU

STPINVALD

STRCPYERR

STRIS_INT

STRLVL

STRNGPAD

STRNOTFOUND

STRNOTWCB

STRTERESC

STRTNOMULTI

STRTOOLARGE

STRTOOLNG

STRTOOLON

STRTRU

STRUCLEV

STRUCSIZE

STRUCT_LEVEL

SUBABORT

SUBALREXI

SUBINTERR

SUBLOCKS

SUBMITERR

SUBOUTBND

SUBRNG

SUBSCHERR

SUBSTRING

SUBSPNERR

SUBSTSERR

SUBTRACED

SUCCDUPACE

SUCCESS

SUP

SUPERSEDE

SUPPORT

SUSPEND

SUSPENDED

SWAPAGINS

SWAPWSLE

SYITSTERR

SYMABR

SYMCREPRC

SYMDCLEXTR

SYMDEFINMO

SYMDEL

SYMDELETE

SYMINSERT

SYMLNG

SYMNAMLNG

SYMNOTABS

SYMNOTACT

SYMNOTFOU

SYMOUTPHAS

SYMOVF

SYMREPLACE

SYMTOOLNG

SYMTOOLONG

SYMTRUNC

SYN

SYNCH

SYNERR

SYNTAX

SYNTAXERR

SYNTAXERROR

SYS

SYSADJWSL

SYSBOOT-F-FBIC

SYSDEV

SYSDIR

SYSDISK

SYSERROR

SYSERRORPC

SYSERROR[[PC]]

SYSFAIL

SYSFAOERR

SYSID

SYSJNLFULL

SYSJNLNAC

SYSLOAD

SYSMGT

SYSMSG2

SYSNAM

SYSNOTUPD

SYSPWDMOD

SYSSRVERR

SYSTRMERR

SYSVERCHK

SYSVERDIF

SZTOOBIG

TABEXIST

TABID_MIS

TABLEFULL

TABNOTFND

TABSUPER

TAMPER

TAPECLASS

TAPEFULL

TAPEPOSLOST

TAPES

TAR

TBIT

TBKBUG

TERMDSBL

TERMENAB

TERMFAIL

TEROUT

TEXT

TEXTD

TFE

TFRSYS

THIRDPARTY

TIMEOUT

TIPCUFLOW

TIRLNG

TIRNYI

TITLE

TITLETRUNC

TKNOVF

TLKINUSE

TMF

TMO

TMP

TMPMBX

TMR

TMS

TMT

TMV

TNS

TOODEEP

TOOFEW

TOOLONG

TOOMANCLS

TOOMANDIS

TOOMANERR

TOOMANNOD

TOOMANPAS

TOOMANY

TOOMANYARGS

TOOMANYCOL

TOOMANYLEV

TOOMANYLNAM

TOOMANYPARAM

TOOMANYREDS

TOOMANYVER

TOO_MNY

TOOMNYARG

TOOMNYARGS

TOOMNYDLM

TOOMNYENDR

TOOMNYFIL

TOOMNYFILES

TOOMNYGST

TOOMNYLIB

TOOMNYOPND

TOOMNYOUT

TOOMNYPSEC

TOOMUCHDATA

TOPLINETRUNC

TOQUIT

TOTAL

TRACEBACK

TRACIGN

TRE

TRMMBX

TRMNOTANS

TRU

TRUNC

TRUNCATE

TRUNCATED

TRUNCDAT

TSTPHSNAM

TTL

TWICE

TWOWIDTHS

TYP

TYPMISMCH

UAEERR

UAFGETERR

UAFOPNERR

UBF

UBMAPEXCED

UDAPORT

UDEFPSC

UDF_BKS

UDF_BLK

UDFENV

UDFSYM

UDS

UICERR

UID_INV

UID_LENGTH

UKNFACILITY

UME

UNABLCREVA

UNABLE

UNAOPNHLP

UNAOPNSRC

UNAREASRC

UNARYOPER

UNASEFC

UNDEFINEDPROC

UNDEFLINK

UNDEFOUTPUT

UNDEFSYM

UNDEFSYNTAX

UNDEFTYPE

UNDEFXFRAD

UNDEXP

UNDFIL

UNDKEY

UNDOPTION

UNDSYM

UNDTERNAM

UNDTERNOP

UNDTERNOS

UNDTERTYP

UNDWIDCLA

UNECLIERR

UNEXPECTED

UNEXPERR

UNEXPEXC

UNEXPIOINT

UNINITVAR

UNIVSTAR

UNKADAP

UNKCLASS

UNKCPU

UNKDEV

UNKENTRY

UNKESCAPE

UNKESCSEQ

UNKKEYWORD

UNKMSG

UNKNFAIL

UNKNOPR

UNKNOWNCLEARINGHOUSE

UNKNOWN_TAG

UNKNPRQ

UNKOBJECT

UNKOPCODE

UNKPKTFMT

UNKREPLY

UNKRSTRT

UNKTYPE

UNKWNDESC

UNLKVOL

UNLOCKED

UNLOCKERR

UNMTCHPARN

UNPRIKW

UNPROPARM

UNPROQUAL

UNQUAKW

UNRCMD

UNRCMP

UNREACHABLE

UNRECSTA

UNRECSTMT

UNRELVOL

UNRFORCOD

UNRFUN

UNRKEY

UNRPTY

UNSAFE

UNSECKW

UNSOLICIT

UNSTLEV

UNSUPRTCPU

UNSVRS

UNTERMARG

UNTERMCOND

UNWIND

UNWINDING

UNXINTEXC

UNXPCTSTS

UNXSIGNAL

UPDATE

UPDATED

UPDURTRAV

UPI

URE

URR

USCALL

USEANS

USEFLORES

USERDSABL

USERQST

USERSPEC

USERVAL

USEUDFEN2

USEUDFENV

USEUDFLSY

USEUNDEF

USEUNDEF2

USGOSUB

USGOTO

USRINPERR

USRTFR

USZ

V2COMP

VALERR

VALNOTADDR

VALPRI

VALREQ

VALTOOBIG

VALUE

VARITH

VASFUL

VASOVF

VBNERROR

VBNMAPFAIL

VBNMISSING

VBNPASTEOF

VCALNORCV

VECALIGN

VECCTXERR

VECDIS

VECEMULTR

VEC_FLOOVEMAT

VEC_FLOUNDMAT

VECFULL

VECINUSE

VEC_INVARGMAT

VEC_LOGZERNEG

VEC_SQUROONEG

VECTOR

VEC_UNDEXP

VER

VERBNOTFND

VERIFYERR

VERIFYICF

VERS_MISMATCH

VETO

VFC

VOIALREXI

VOLALRMNT

VOLIDENT

VOLINSET

VOLINV

VOLMOUNT

VOLNAME

VOLOERR

VOLSETSTS

VOLSHDWMEM

VOLSTATUS

VOLUME_FULL

WACKQEMPTY

WAITERR

WAITIDLEBCB

WANTOSEND

WARNING

WARNISUE

WASECC

WBE

WCBFCBMNG

WCC

WCSCORR

WDW_MAXPREV

WDW_MAXPRM

WER

WFR

WIDMISMATCH

WILDCONCAT

WILDOVTVER

WILUSERMS

WINDNOTMAPPED

WINDNOTVIS

WINEXISTS

WINK

WINTRUNCFIT

WKQERR

WLD

WLDNOTALWD

WLK

WORK_DEV

WORKSTACMD

WPL

WPTTRACE

WRIRSPMSG

WRISMBMBX

WRITEACT

WRITEATTR

WRITEBACK

WRITEBLOCK

WRITEBOOT

WRITECHECK

WRITECHECKREC

WRITECUR

WRITEERR

WRITE_ERR

WRITEERRREC

WRITE_FAILED

WRITEFILE

WRITEHEADER

WRITEHOME

WRITEIBMAP

WRITE_INTO_KERNEL

WRITE_INTO_KERNEL_STACK

WRITEJNLACE

WRITELOCK

WRITEMON

WRITENABLE

WRITERRS

WRITESBMAP

WRITESCB

WRITLCK

WRNERS

WRONGACMODE

WRONGACP

WRONGDATASET

WRONGOWNER

WRONGSTATE

WRONGVOL

WRONUMARG

WRTEVT

WRTFIL

WRTHOMBLK

WRTINVBUF

WRTINVHDR

WRTPGSBAK

WSLENOVAL

WSLPAGCNT

WSLVANVAL

WSLXVANMAT

WSSIZEERR

XAB

XNF

XORERRS

XQPERR

YES

YESNO

ZEROLEN

ZEROPAGE

Advance past bottom of buffer

’AS’ required

BIIC failure-BICSR/BER/CNF ’xxxxxxxx/xxxxxxxx/xxxxxxxx’

BVP failure-Status/Error/Data ’xxxxxxxx/xxxxxxxx/xxxxxxxx’

BVP timeout-Status/Error/Data ’xxxxxxxx/xxxxxxxx/xxxxxxxx’

Cannot set terminal type from change mode

Error opening terminal for input

Error opening terminal for output

Error reading from input file

Error reading from terminal

File specification required

Micro-code Verification Error

No Path-Block During Virtual Circuit Close

Parallel Path is Closing Virtual Circuit-REMOTE PORT ’xxx’

Port Error Bits Set-CNF/PMC/PSR ’xxxxxxxx/xxxxxxxx/xxxxxxxx’

QUEisEMP

SYSBOOT-F-Invalid console ID

SYSBOOT-F-Microcode revision level too low to boot

SYSBOOT-F-Not enough nonpaged pool to map

SYSBOOT-F-Pageable system space exceeds 512 MB

SYSBOOT-F-PFN allocation overwrites CI ucode

SYSBOOT-F-PFN bit map conflict-Physical page count set too low

SYSBOOT-F-System

SYSBOOT-F-Unable to allocate physical memory

SYSBOOT-F-Unable to allocate PTEs for Boot Driver

Unexpected Interrupt-CNF/PMC/PSR ’xxxxxxxx/xxxxxxxx/xxxxxxxx’

Unrecognized command

Unrecognized command option

System Messages — VMS 5.4

Additional information available:

Errors

Errors

Additional information available:

AAAABENDABENDDABENDTABFNAMABKEYWABKW
ABNORMAL_EXITABORTABORTCABPRIKWABSENTABSTIMREQ
ABSYMDABVERBACCACCADDCOMACCCIRACCDISERR
ACCERRACCESSFAILACCLINACCONFLICTACCOUNT
ACCQUOTAACCVIOAC_LSS_MPACPMBFAILACPNAME
ACPRECURSACPSHOACPTIMEACPUNSTAKACPVAFAIL
ACPVAFULACSACSIGNACTACTIVEACTIVEBCB
ACVINORCVADDERRADDFILADDFILEADDMSGADDQUOTA
ADDRANCOVADJSCROLLREGADRLSTSYNXADRWRTDAT
ADVADVCOMPADVADVERSENDADVALLOCADVBADFORMAT
ADVBTIMADVCACHEINITADVCANTIMADVCHUIDADVCLILOADFAIL
ADVDEASGNADVDEFCONNADVDEFLOADADVDEFOPEN
ADVDEFPARSEADVDEVCHECKADVDUMPFAILADVETHERMEM
ADVMBXADVNICKUIDADVPRIVADVRANDOMADVRECBUF
ADVRECREATEADVREREADADVSETIMRADVSOLCOMP
ADVTIMERRADVUIDNICKADVWRITETHERAGAIN
AIDALCPHDALCSMBCLRALIALIGNDISKALIGNXCEED
ALLOCALLOCCLRALLOCEXTALLOCFAILALLOCMEMALLOCSET
ALNALPBFOVFALQALRCURTIDALREDEFALTIHDBAD
AMBCMDAMBDATTIMAMBIGAMBIGNAMEAMBIGSYMUSED
AMBKEYAMBSYMDEFANIAOPAPPENDEDB
APTREFHIGHAPTWRTERRAQBTIMEARCHIVEDSB
ARCHIVEMOVEARCHIVENEWARCNOTDISKARCOPENFAIL
ARGMISMATCHARGREQARGTOOLONGARTRESASCEFCFER
ASCTOOLONGASGNMNTSYNASGNQUEASSIGNASSIGNFAIL
ASTFLTASTRPDFERASYNCACTIVEASYNCWRTER
ATLINEATPCATPROCLINEATRATTACHEDATTCONSTO
ATTREQREFATWAUTOMEMCOPYAUTOMEMERGE
AUTOMEMSUCCAUTOSYNCBACKLINKBACKUPERRBADACC
BADACPBADACTRLBADALORQSZBADARGSBADASSIGNBADATTRIB
BADBITMAPBADBLKBADBLKSIZEBADBLOADR
BADBLOCKBADBLOCKSBADBLOSIZBADBOOTCBBADBUFADR
BADBUFTYPBADBUFWRITEBADBUGBADBYTEBADCACHE
BADCASEBADCASELIMITBADCASERANGEBADCCCBADCHAR
BADCHKSUMBADCONDEVBADCOPIESBADCSP
BADCTLMSKBADDALRQSZBADDATABADDATCHK
BADDATDATBADDATLENBADDELETEBADDELIM
BADDENSBADDEVBADDIRBADDIRENTBADDISDEV
BADDISDIRBADDSTBADDSTMAPBADDSTVBNBADECO
BADEFBLKBADENTRYBADESCAPEBADEVTYPBADEVVALBADEXCL
BADEXCLNAMBADEXEBADEXECLOBADEXERAB
BADEXHBADEXITIFBADFIDBADFIELDBADFILEBADFILEHDR
BADFILENAMEBADFILEVERBADFIRSTLINEBAD_FIXUPVEC
BADFLAGBADFORKIPLBADFORMBADFRAMEBADFRMTBADFUNC
BADGETDIRBADGSDBADHDRBADHEADERBADHIBLK
BADHOMBLKBADIDENTBADIFBADIMGHDRBADINDEX
BADINITSZBADIONAMEBADIRECTORYBADISDBADJOBID
BADJOBNAMEBADJOUCHARBADJOUCOMBADJOUCPOS
BADJOUEDITBADJOUEIGHTBADJOUFILEBADJOUINIT
BADJOUINPUTBADJOUKEYBADJOULINEBADJOULPOS
BADJOUPAGEBADJOUSECBADJOUSTRBADJOUTERM
BADJOUWIDTHBADJRNLBADKEYBAD_KEYBADLABELQ
BADLCKWSLEBADLEXARGBADLEXFORMBADLOGIC
BADLOGICPCBADLONGBAD_LRLBADMARGINSBADMATCH
BADMCKCODBADMODEBADMODNAMBADMOPFCT
BADMOPPGMBADMOPPROCBADMOPSIDBADMOPVER
BADMSGBADNODFORMBADOFFSETBADOPCODE
BADOPENBAD_ORDERBADOUTBANDBADOVRBADPAD
BADPAGFILABADPAGFILDBADPAGTYPEBADPARAM
BADPARSETBLBADPATBADPKTBADPNAMEBADPRO
BADPROCBADPROCNAMEBADPROGBADPROGDELETEBADPROMPTLEN
BADPRTYBADPSCBADQFILEBADQHDRBADQNAMEBADQUAL
BADQUEUEHDRBADRANGEBADRCTBADREADBADREFCNT
BADREPLYBADREQUESTBADRETURNBADRSEIPLBADRVNWCB
BADSBMBLKBADSCOPEBADSECTIONBADSEQNUM
BADSETAFFBADSETCNTBADSIGARGBADSORT
BADSPCBADSPECBADSPLINDEXBADSPLNAMEBAD_SRL
BADSTABADSTACKBADSTARTBADSTARTPCBADSTATUS
BADSTRCNTBADSTRLVLBADSTRUCTBADSUBFCN
BADSWPVBNBADSYMBADSYMTABBADTAGVAL
BADTARGETBADTIMEBADTYPEBAD_TYPEBADUICBADUSERDESC
BADUSRBADUSRDATBADUSRLENBADVALUEBADVEC
BADVOL1BADVOLACCBADVOLLBLBADWATCH
BADWCBPTBADWIDTHCHANGEBADWINDADJUSTBADWINDLEN
BADWORDBADZONEBASDUERRSBASESYMBASSHRBEL
BATCHNOOPRBATIS_OFFBATIS_ONBATSTIPROBBFOVFBBFWRT
BBLHEADERBDPPURGERRBEGINBEGINDBEGINT
BEGNLENDBEGOFBUFBEGOFFILEBEGRANBESBINARYOPER
BINCHKSUMBINRECFMTBITMAPERRBITMAPINV
BITRANGEBKSBKZBLK0BADBLKDIRSYNXBLKEXPNABS
BLKZEROBLNBLOCKCHECKBLOCKCHECK0BLOCKCNTERR
BLOCKCRCBLOCKLOSTBLPRSPBMSBOFBOTLINETRUNC
BRDCSTBRDESTRANGBRDMSGLOSTBREAKBRKNLIB
BRTOOFARBUFBLKREQBUFBYTALIBUFFEROVFBUFFERSLOST
BUFNOTALIGNBUFOVFBUFOVFLBUFOVRBUGBUGCHECK
BUG_DAPBUG_DDIBUSYBVNCACLSCAFINVGROUP
CAFNEITHERCAFNOTCLUCAFOLDGROUPCAFOLDPASS
CAFPASSLENCAFREBOOTCALLOVERCALLUSERFAIL
CANCELCANCELEDCANCELQUITCANNOTUNSELCANT_BIND
CANTACCESSMAINCANTBALCANTEXPREGCANTGETFID
CANTLOCKCANTLOCMACCAPTINTCAPTINQCAPTIVECARDS
CASETOOLARGECBTCCFCCRCDACEBREFNEG
CEMCENTRLCHAINWCHANCHANGE_INVCHG
CHKCHKALTHOMECHKPRIHOMECHKSCBCHMONIS
CHMVECCHNCINBADCINREJCIPORTCIREXLSTCJFERR
CJLCLASDISABCLASMISSCLASNPCLASUNKCLIERRCLIFAIL
CLIFRCEXTCLIMISMATCHCLIPBOARDFAILCLIPBOARDLOCKED
CLIPBOARDNODATACLIPBOARDZEROCLIPROTCLIQUALCLISYMTBL
CLIWARNMSGCLOSEDELCLOSEERRCLOSEFILECLOSEFOREIGN
CLOSEINCLOSEJOBCLOSEMONCLOSEOUTCLREFCFERCLSERR
CLSTBLERRCLUBELBASCLUEXITCLUGDIFFCLULIST
CLUPDIFFCLUSTERCMDCANCMDERRCMDINPUTCMDLINCMDNOTFND
CMDNOTVLDCMDOBSCMDSYNTAXCMDTOOLONG
CMODSUPRCMODUSERCMPOUTF11CNFCNFOVRCNFQUAVAL
CNSCNTERRCNTRLYCNVRTINGCNXMGRERRCOB
CODCOFCOICOLLERRCOMBCLUCOMCODCOMFAIL
COMFILCOMFILEMTYCOMMACOMMHARDCOMOREXE
COMPAREDCOMPATCOMPBEGINCOMPENDCOMPFAILCOMPILED
COMPILEFAILCOMPLETECOMPLXCOMPSYNCCOMREMJBC
COMSTACONABORTCONCATCONCEALEDCONERRCONFATTR
CONFBASADRCONFCONCONFDEFREQCONFDELCONFDIS
CONFFACCONFIXMEMCONFLICTCONFMEMCONFNEGCONFNOCON
CONFNODISCONFNONNEGCONFNOPARMCONFNOQUAL
CONFOUTPUTSCONFPARMCONFQUALCONFROUTIMGCONNEC
CONNECFAILCONSEQERRCONSTRTOOLARGECONTINUE
CONTINUEDCONTRACTCONTRADEFCONTROLCCONTROLO
CONTROLYCONVERT_STALLCOOCOPIEDCOPIEDBCOPIEDC
COPIEDRCOPMSGCOPY_LOGCOPY_LOG_ENDEDCOPY_LOG_LINE
CORCORRUPTEMBCPUCEASEDCPUEXITCPUNOTACT
CPUNOTVLDCPUSANITYCPUSPINWAITCPUSTARTD
CPUSTARTIPCPUSTOPPINGCRCCRCLSCRE
CREA_ERRCREATDIRCREATECREATEDCREATED_SOMECREATEDSTM
CREATEFAILCREATELOSTCREATEVIRTCREDIR
CREDIRERRCREERRCREJOBCRENEWFOLDCREPARFIL
CREPRCCREPRCFALCREPRIJOBCREQUECRE_STMCRF
CRFERRCRMPCRMPSCCRPCTRLCEXITCTRLCHAR
CTRLCJOUCTRLERRCTRLYCTXSTSERRCURCUREXEC
CVTERRCVTUNGRANTCWFDACDANDATACHECK
DATADEVERRDATAERDATALSTSYNDATAOVERUN
DATAOVFLDATATRUNCDATFILCREDATMISMCHDATTOOLNG
DBCORRUPTDBGERRDBGTFRDBLERRDCVNOTFND
DDIFINDDIFOUTDEADLOCKDEBUGDECNETDECOVFDECPTREF
DECTSTFAIDEFAULTEDDEFAULTLENDEFCHARSTIC
DEFERRDEFFORMDEFFORUSEDEFKEYDEFOVFDEFPWD
DELDELACCESSDELCONPFNDELDATERR
DELETEDELETEDDELETEFAILDELETESWLDELEXIGBL
DELGBLSECDELGBLWCBDELHEADERDELHEADER_BUSY
DELKEYDELKEYERRDELSYMDELTIMREQDELTVA
DELVERDELWSLEXDENOSUDENSITYDEQSUBLCKSDESSTROVF
DESTPDEUNUSDEVDEVACTIVEDEVALLOCDEVALRALLOC
DEVALSPLDEVASSIGNDEVCLASSDEVCMDERRDEVCOUNTDEVFOREIGN
DEVICEDEVICEFULLDEVICESDEVINACTDEVMNTDEVMOUNT
DEVNOTALLOCDEVNOTBLKDEVNOTERMDEVNOTEXIST
DEVNOTFORDEVNOTKNWNDEVNOTMBXDEVNOTMOUNT
DEVNOTSPLDEVNOTSUITDEVOFFLINEDEVOFFLINX
DEVONLINEDEVONLYDEVQUALSDEVRCTDEVREQERR
DEVSELREQDEVSPECDEVWRTLCKDFLDGQINCOMP
DIAGNOSTICDIAGPACKDIALFAIDIALINNOTDIFACCTSDIFCHARS
DIFLWDSDIFSTRINGSDIFTIMESDIFTYPDIFVALDIR
DIRALLOCDIRECTDIRE_ERRORDIRENTRYDIRFULLDIRNAME
DIRNOTCREDIRNOTEMPTYDIRSYNXDISCONDISCONNECT
DISKCLASSDISKFRAGDISKSDISMALDISMOUNTDDISMPART
DISPCHARSTICDISPERRDISPFILEDISPFORMDISPJOBDISPLAY_SHORT
DISPQUEDISREQDIVBY_ZERDIVBYZERODIVZERO
DNADNFDNRDNSDOESNTFITDONEMSG
DOS11_BADLABELDOS11_BLOCKSIZEDOS11_IOERRORDOS11_POSITION
DOUBLDALOCDOUBLDEALODPEDQCLUSDRIVENAM
DRVERRDRVRSTRTDSAQUOTADSTNESDEPDTPDTRBADMAIL
DTSBADMAILDUALLOCDUMPEMPTYDUMPERRORS
DUMPINCOMPLDUPDUPBLKNUMDUPBUFNAME
DUPCOMFILDUPDEFDUPDEVSPCDUPDSKQUOTA
DUPFILENAMEDUPFORMDUPGLOBALDUPIDENTDUPINVALID
DUPKEYDUPKEYMAPDUPKEYMAPLISTDUPLABELDUPLNAM
DUPMODDUPMODULEDUPMSGDUP_OUTPUTDUPPLACE
DUPPREFIXDUPPROMPTDUPQUALDUPRVNDUPSYM
DUPSYNTAXDUPTYPEDUPUNITDUPVALUEDUPVOLNAM
DVIDVNDX1DX2ECONOTSETECOSET
EDITPROCEDITSCLSHEDOUTSEQEF_ALRFREEF_ALRRES
EFDEF_RESSYSELDELEALREXIELETOOLONEMPTY_CHECK
EMPTYDEFEMPTYFILEEMPTYHISTEMPTYINEMPTYJOB
EMPTYKMLISTEMPTYLIBRARYEMPTYLSTEMSKNOTABS
ENAQUOTAENDENDABORTENDDIAGSENDEDENDEDDENDEDT
ENDNOOBJENDOFBUFENDOFFILEENDOFTAPEENDOFVOLUME
ENDPRSENDTOPICENDWRNGMACENGLUSEDENQENT
ENTEREDENTERLOSTENTERRENTFILENTIDMTCH
ENTIDMTCHBENTIDMTCHOENTIDMTCHTENTNF
ENVENVNOTSETEOFEOFMISMATCHEOMERROR
EOMFATALEOMFTLEOMSTKEOMWARNEOTINEQV_NOTICE
ERACTEDERASEBLKSERASEFAILERBOXPROCERRASSIGN
ERRAT_LINERRCACHFULERRCLSFILEERRCRELNM
ERRCVTFILERRCVTOPNERRDEASSIGNERREXECOM
ERREXEFILERREXEOPNERREXEREAERREXEREP
ERRFAOERRFREDYNERRGETDVIERRGETEFERRHALT
ERRINPFILERRINVEDITERRLINERRORERROR_HALT
ERRORISUEERRORSERROUTOPNERRPARSEERRPHOTRA
ERRPROMPTERRQIOWERRRECFILERRROUCALERRSMG
ERRSYMACTIVEERRSYSINFOERRSYSSERVERRTSTMOD
ESAESCAPEESLESSESTABCONEVENT_OCCURRED
EVLEVTSIZEXARANGEEXASTLMEXBIOLMEXBYTLMEXCDURCAL
EXCPSCEXCPTSTEREXCPUTIMEXDEPTHEXDIOLMEXDISKQUOTA
EXEABOEXECUTEFAILEXECUTINGEXENQLMEXFILLM
EXGBLPAGFILEXHFULEXHNEVCALEXISTSEXITFAIL
EXITINGEXITSTATUSEXLNMQUOTAEXPEXPAGQUO
EXPANDPHDEXPCOMPLEXEXPECTEDEXPGFLQUOTA
EXPIREDEXPORTQUOTAEXPOVR32EXPRCLMEXPREGEXPSHRPAT
EXPSTKOVREXPSYNEXPTOOCOMEXPVIREXQUOTA
EXTEXTBITEXTCACHIVEXTENDEXTENDEDEXT_ERR
EXTN_ERREXTNOTFOUEXTNOTFOUNDEXTQELMEXTRACTED
EXTRAENDMEXTRANEOUSARGSEXTRAPARMFAB
FACFACOVFLFACTBADFACTOOLONGFAILFAILED
FAILFREVMFAILGETVMFAILUREFAILURE_STATUS
FAIOPEFILFAOFAOBUGFAOFAILFATALERRFATALERROR
FATALEXCFATALEXCPTFATERRLIBFATINTERRFAUFCPREADERR
FCPREPSTNFCPREWNDERRFCPSPACERRFCPWRITERR
FDEXNORCVFDLERRORFDLPARFDLPARSEFELFEX
FFVSDIVERFFVSMLTERFFVSSBTERFFVVADDER
FFVVDIVERFFVVMLTERFFVVSBTERFIDERROR
FIDNOTFNDFIDNUM_ZEROFIELDLIMFIL11_NOREC
FILACCERRFILADDEDFILALRACCFILAREDIFFILCNTNONZFILDISABL
FILE_ABSENTFILE_EMPTYFILE_EXISTSFILEACC
FILECONVERTEDFILEGONEFILEINFILEIOFILELOCKED
FILEMPTYFILENABLFILENOTFOUNDFILENUMCHKFILEOUT
FILEPURGEDFILESEQCHKFILESTRUCTFILETOOLONG
FILLIMFILMODIFDFILNOPOSTFILNOTACCFILNOTCNTG
FILNOTDELFILNOTEXPFILNOTFNDFILNOTPUR
FILOPEFILPURGEDFILREMOVEDFILREQDFILTOOLON
FILTRNERRFINDHOMEFINDIHDFINISHEDFIRSTMODFLAGTRUNC
FLGFLKFLOOVEMATFLOUNDMATFLOVNORCV
FLTDIVFLTDIV_FFLTOVFFLTOVF_FFLTPNTSYNXFLTUND
FLTUND_FFLUNNORCVFLUSHFNAFNDFNF
FNMFOPFORCEDERRORFORCEDEXITFORGET
FORM_ABORTFORMATFORWLOOPFPART_SECTNFREEBADBUF
FREEMEMFREEPAGREFFREEVMFRERANGEFRESIZEFREWSLX
FROMBUILTINFROMLINEFROMPROCLINEFRZNCTXFSZ
FTMFULFUNNOTSUPFUTBAKDATFUTCREDAT
FUTREVDATFWFGBCGBLNDFGBLNOTCRE
GBLONLYGBLPAGSZROGBLSECMAPGBLSELOWNER
GBLWARNGBLWSLXERRGENERRGEN_MAXGENMINUS1
GENWRNGETCHNGETDVIGETERRGETJPIGETJPIERRGETMEM
GETMSGGETPTIERRGETTIMGETVMGFCGFVSADDER
GFVSDIVERGFVSMLTERGFVSSBTERGFVVADDER
GFVVDIVERGFVVMLTERGFVVSBTERGOSUBMAX
GPGNULPGFLGPTFULLGRANTERRGRANTMSGGSDFULL
GSDTYPHALTHALTEDHANGUPHBREADHBWRITEHDRBLK
HDRCRCHDRERRSHDRNOTMAPHDRNOTRESHDRTRUNC
HEADCOPIEDHEADER_DELHEADERFULLHELP
HELPERRHIBHIBERHIDDENHIGHVERHISTERRHOMBLKBAD
HOMBLKCHKHRDFAIIALIANIBFIBK
IBOICONCLUDATICONPFNDATICPAGELOC
ICVNOTFNDIDDIDENTIDMISMATCHIDMISMCH
IDOUTRNGIDRIDXIDXCONCATIDXFILEFULL
IDXHDRBADIDX_LIMIDXMAPERRIFAIFDIRSYNX
IFEXPRNABSIFFIFIIFLIFLEVLXCED
IFREPAGCNTIFTIGNCLIFLAGIGNFILIGNORED
IGNORE_DIREIGNORE_VERSIGNQUALIIFILC
ILEILLANSIBSILL_ARGILLARGDESCILLASCARGILLBATFNC
ILLBLKNUMILLBRDESTILLCDTSTILLCHRILLCNTRFUNC
ILLCOMPONENTILLCREOPTILLCTLILLDESQUEILLDFLTARG
ILLEFCILLEGALTYPEILLEVTNUMILLEXPRILLFMLCN
ILLFMLCNTILLFMTILLFORMATILLFUNCILLIDXNUM
ILLIFCONDILLINDXREGILLINISTRILLINROUILLIOFUNCILL_KEY
ILLKEYLVLILLMACARGNILLMACNAMILLMASKBIT
ILLMODEILLMODNAMILLMTCOPYILLNAMELEN
ILLOPILLOPDEFILLOPDEFVLILLOPTILLOUTROU
ILLPAGCNTILLPATASILLPSCLENILLQUALILLQUALVALILLRECLEN
ILLRECLN2ILLRECTY2ILLRECTYPILLREGHEREILLREGNUM
ILLREQUESTILLRQSTILLSAVESETILLSELFILLSEQOP
ILLSERILLSEVERITYILLSHROPRILLSHRXPRILLSIGEXTILLSTRCLA
ILLSTROPSILLSTRSPEILLSYMLENILLTIRILLTYPILLTYPEILLVAL
ILL_VALUEILLVECILLVECOPILLVPSIMAGEFMTIMAGEFNFIMAGELEN
IMAGE_NOT_FOUNDIMGADDEDIMGBASEDIMGDUPINVIMGFILGON
IMGFILSPEIMGHDRIMGINVIMGNAMEIMGNOTFNDIMGRECSIZ
IMGREMOVEDIMG_SIZIMGTRACEDIMGVEXCIMX
IN_BARRIER_WAITINBUILTININCBADDIRINCCTXTINCDATTIMINCDELERR
INCDELETEINCDEVLISINCDSTNESINCDSTQUEINCDUMPFORM
INCENTERRINCFILATRINCFILSPEINCFORMPARINCHMK
INCKWDCOMINCMEMNAMINCMVEINCOMPACP
INCOMPATINCOMPEXIINCOMPLINCOMPLETEINCOMPSHR
INCONISDINCONQUALSINCONSDEVINCONSTATE
INCPTREFINCQUETYPINCQUOTAINCRVNINCSEGTRA
INCSETCNTINCVOLLABELINDEXINDEXERRINDEXOVFL
INDEXTYPEIND_OVRINHCHMEINIINIACCINIERR
INITERRINITIALINITPRSINMINOVNORCVINPBUFOVR
INPCONERRINP_FILESINPSTRTRUINPTOOLONINPUT
INPUT_CANCELEDINPUTERRINSCLIMEMINSCOLLINSDFAILINSEF
INSERTEDINSERTERRINSFAILINSFANLINSFARGINSFBUFDPINSFCDT
INSFMAPREGINSFMEMINSFPRMINSFRAMEINSFSPTSINSFVM
INSFWSLINSKIPPEDINSLUNINSNFREPAGINSOPRNDINSQUOCRE
INSSWPFILINSUFFMEMINSUFPATINSVIRMEMINSWAPERR
INTDATCORINTDELPRCINTDIVINTEGERINTERLOCK
INTERNALINTERRINTHCHARINTINVNODEINTLOGERR
INTMEMERRINTNODESPACEINTOVFINTPATHSTKOV
INTRNLERRINTSTKOVINTSTKUNINTTERMININVACC
INVACCESSINVACCRECINVADAPINVALIGNINVALQUAL
INVARGINVARGMATINVARGORDINVARRDSC
INVATTSIZINVATTSTRINVATTVALINVBJLEOFINVBJLSIZINVBJLSTRINVBJLTYP
INVBKTINVBLKINVBLKHDRINVBLKSIZEINVBLKTYP
INVBLOCKINVBTIMSPINVBUFDELETEINVCALLINVCCFILINVCHA
INVCHANINVCHANAMINVCHANUMINVCHARINVCHDABS
INVCJFIODINVCLADSCINVCLADTYINVCLIFLAG
INVCLSNMINVCMDINVCOLINVCOLARGINVCONTINVCPUID
INVCTXINVCTXTYPINVCVTINVDATAINVDATIMINVDEF
INVDEFATTINVDEFINEINVDELIMINVDESCINVDEVINVDEVICEINVDEVTYP
INVDIRINVDIRNAMINVDIS_IDINVDPTINVDPTINIINVDSTQUE
INVDSTRECINVDTYDSCINVELEIDINVELENAM
INVELETYPINVETIMSPINVEVEINVEXCEPTNINVEXHLIST
INVEXPINVEXTBACKINVEXTFIDINVEXTHDRINVFAOPARAM
INVFCBDESCINVFCOINVFIDINVFILEXTINVFILSPEINVFIXDST
INVFLUSHSPINVFORNAMINVFORNUMINVFUNC
INVFUNCODINVGBLSELDATAINVGOSUBINVHEADER_BUSY
INVHOMBLKINVIDEINVIFNESTINVIMGHDRINVINPDMN
INVINPFILINVINPUTINVINTSPINVIOCODEINVITEMINVITEMCODE
INVITEMNMINVITMCODINVKBD_IDINVKEY
INVKEYCHARINVKEYNAMINVKTB_IDINVLDADR
INVLDRESPINVLOCKIDINVLOGINVLOGFILINVLOGININVMAPINVMAR
INVMAXLENINVMODEINVMSGINVMSGBUFINVNAM
INVNBDSINVNUMBERINVNUMCHIINVNUMSRC
INVNUMSTRINVOOBINVOPCODEINVOPERINVOPEZON
INVOPRINVOPRNDINVOPTIONINVOPTIONSINVOUTDMN
INVOUTSPEINVOVERQUOTAINVPAGARGINVPARAM
INVPARFILINVPARLENINVPARMINVPARVALINVPAS_IDINVPASS
INVPATHINVPERMQUOTAINVPGPINVPLACEINVPRVNAM
INVPTEFMTINVPVAINVPWDINVPWDLENINVQUAL
INVQUAVALINVQUENAMINVQUOINVRANGEINVRECFMT
INVRECORDINVRECSIZINVRECTYPINVREPTYP
INVREQINVREQCODINVREQPARMINVREQTYP
INVRFAINVRFMINVROUTINVROWINVRSPINVRSPIDINVSCRPOS
INVSEMINIINVSEMMAXINVSHDWMEMINVSMGINVSPEED
INVSRCLININVSTANAMINVSTLEVELINVSTMNBR
INVSTRINVSTRDESINVSTRLEVINVSTRUCTINVSYMNAM
INVTABINVTABSPECINVTERTABINVTIMEINVTOKEN
INVTQEFMTINVTYPEINVUICINVUSERINVUSERNAME
INVUSERSPECINVVALINVVALCLAUSEINVVECINVVIEWSP
INVVMSOSCINVVOI_IDINVVOLFMTINVWIDARG
IO_CONCLOIOERRORIOPIRCISD_OFFISD_SIZ
ISD_VBNISIISQUALITCITDITEMNOTFOUND
ITERATIONITMNOTDEFIVADDIDIVADDNODEIVADDR
IVATIMEIVBAKADIOIVBLKENTIVBLKNUMIVBUFLENIVCHAN
IVCHARIVCHNLSECIVCMDIVDEVIVDEVNAMIVDTIMEIVFNAM
IVGBLTYPIVGSDNAMIVKEYNAMIVKEYWIVLISTKIVLOCKIDIVLOGNAM
IVLOGTABIVLVECIVMODEIVOPERIVORDERIVPFAILIVPROT
IVPROTECTIVQLOCIVQUALIVQUOTALIVREMIDIVREMNODE
IVSIVSECFLGIVSECIDCTLIVSSRQIVSSRVRQST
IVSTSFLGIVSYMBIVTIMEIVTYPEIVVALUIVVERBIVWSETLIST
JBCERRORJBRTAINHLDJECJNLACPJNLACTIVEJNLDRV
JNLNOTAUTHJNLNOTOPENJNLOPENJNLPUTJOBABORT
JOBCARDJOBCTLABORTJOBDELETEJOBQUEDISJOBQUEENA
JOBREQUEUEJOURNALJOURNALBEGJOURNALCLOSE
JOURNALEOFJPITSTERRKBFKEYKEYALRINSKEYAMBINC
KEYCNVKEYDEFPROKEYEDKEY_LENKEYMAPNOTFND
KEYNAMLNGKEYNOTDEFKEYNOTFNDKEYNOTFOU
KEYSUPERSEDEDKEYWORDPARAMKFFKNMKRF
KRNLSTAKNVKSIKSZLABELERRLANLARGECNT
LASTCHANCELCKPAGFULLDELENMUSONE
LENNOTEQLLENVIOLEXLIBFINDLIBNAMLNG
LIBNOTOPNLIBOPNLINCOMLINEABRTLINEINFOLINERR
LINETOOLONGLINKLINKABORTLINKACTIVE
LINKDISCONLINKEXISTSLINKEXITLINNOTFND
LINPROLINTOOLONGLISINPSAVLISTENDSBLISTENENAB
LISTENFAILLISTENNOTMBXLISTNOTFNDLKBGRANTED
LKBREFNEGLKPNOTDONLKWSETFULLNE
LNKLOADERRLOADIDXLOCKEDLOCKHEADERLOCKMGRERR
LOCKVOLLOCNEGLOCNOTESTLOCPRESLOGCLOSLOGDBUR
LOGDBUTLOGFAILOGFAILLOGICLOGINITLOGNAMELOGIO
LOGLINKLOG_IN_USELOGOPNMLOGOPNRLOGOPNTLOGTIME
LOGZERNEGLONGDSTLOOKUPERRLOSTEXTHDR
LOSTHEADERLOSTSCANLOWQUOTALRL_MISSLSTERR
LSTMSG1LSTMSG2LSTTOTBKLTCLUNALRFRELUNRESSYS
LVSADDERLVSMLTERLVSSBTERLVSSHLERLVSSHRERLVVMLTERLVVSBTER
LVVSHLERLVVSHRERMACHINECHKMACLBFMTERMACNAMLNG
MAILBOXMAKEWSLEMANY_TO_ONEMAPAREAMAPCNTZER
MAPHDRBADMATCHMATCHEDMATQUOMISMAXBAD
MAXDEVMAXDIFMAXLABMAXLINKSMAXMAPPEDBUFMAXPARM
MAXSERVMAXTOOBIGMAXUNITSMAXVALUEMAXVOLSMAYNOTINDX
MBACBHUNGMBCMBFULLMBTOOSMLMBXASGERR
MBXCRERRMBXCRTERRMBXRDERRMBXREDERR
MBXWRTERRMCHECKMCHINSTSYNMCNOTVALID
MDBSFCRUPTMDBSFRFAIMDFYERRMDFYMSGMEDOFL
MEIMEMBUGMEMERRSMEMFULMEMNOTSVDMERGE
MFNMFSMFYNULPGFLMGTPRMMHDERRMINVALUE
MIRBFOVFMIRCTFMIRDISMISCONFUNIMISENDSTA
MISFILSPEMISINVNUMMISMODBEGMISMODEND
MISNAMREQMISREQPARMISSINGENDMISSINGQUOTE
MISSNGPARMMISSNGSYMMISS_PARAMMISSPASS
MISSQUOMISSQUOTEMISSYMTABMISTERNAM
MIXEDTYPESMKDMLBOPNERRMNLMODIFIED
MODIFYERRMODNAMMODNAMLNGMODNOTADD
MODNOTFNDMODOUTAIMODOUTAISMODOUTBIMODOUTBIS
MODQUOTAMODRANGEMARKSMODRELNBAKMOUNEWVOL
MOUNTDEVMOUNTEDMOUNTERRMOUNTERROR
MOUNTF11MOUNTFORMOUSEINVMOUVOLMOVEFILES
MOVETOCOPYMQSMRCMRGMRGGTMTCH
MRNMRSMSCPNOTLDMSCPSERVMSGBUFSET
MSGCMAIIFMSGNOTFNDMSGQUEEMPTYMSTINTERR
MTLBLLONGMTLBLNONAMTXCNTNONZMULCLUOPT
MULDEFMULDEFLBLMULDEFPSCMULPRIMULPSC
MULSECMULSHRPCSMULTALLOCMULTCHNGMULTECO
MULTEXTHDRMULTFRMULTIDEFMULTIPLENAMESMULTISELECT
MULTOPRMULTRMSMUSTBECONSTMUSTBEONEMUSTCLOSEFL
MVABORTEDMVCOMPLETENAFADDERRNAFAEX
NAFCONERRNAFCREERRNAFDNENAFDONEMSG
NAFNOMODSNAFUAEERRNAMNAMETOOBIG
NAOFILNAONAFNARGNCBFAILNCSNEEDBOTHNEEDFILENAME
NEEDMORENEEDTERMSNEEDTOASSIGNNEF
NEGATEDNEGSHBREFNEGSTRLENNEGTIMNESTERROR
NESTLEVELNETNETASNNETDASNETDISNETERR
NETFAILNETIONETIOERRNETLSTMSGNETMBXNETNOBUF
NETNOSTATENETRCVPKTNETSYSSRVNETTRANCNT
NETWORKNEWCOMPFILNEW_FILENEWFILESNEWIGNORE
NEWSERVERDBNEWPAGENEWQUEUENEWSAVSET
NEWTAPENEXNOTUBANEXTVOLNIANICNMF
NMLRSPNONOACCESSWNOACCMANNOACCPTMSG
NOACESSNOACNTNOACPCHANNOACPDEVNOACPMAIL
NOADAPTERNOALLOCNOALLSPOOLNOALTPRINOANGLE
NOANSWERNOAQBNOAQBACPNOARGNO_ARGSNOASSIGNMENT
NOAUTOCNFNOAVAILNOBACKUPNOBADDATANOBADINFO
NOBITMAPNOBRANCHNOBREAKPOINTNOBREAKSNOBUFPCKT
NOBUGCHKNOBVPVCBNOBYPASSNOCACHENOCALLSNOCALLUSER
NOCARRIAGENOCCATNO_CHADISNOCLASSNOCLASSES
NOCLINOCLITABLENOCLUDEVNOCLUSTERNOCMDMEM
NOCMDPROCNOCMEXECNOCOMMUNICATIONNOCMK
NOCMKRNLNOCOMDNOCOMMSTLEVNOCONNECT
NOCONSOLENOCONTIGNOCONVBOOTNOCOPBADNOCOPBADDEL
NOCOPDUPNOCOPLOCKNOCOPNODELNOCOPPROT
NOCOPSAMDEVNOCOPSYSDELNOCOPYBOOTNOCOPYBUF
NOCPUSNOCSPNOCURLOCNOCURRENTBUFNOCURTIDNOD
NODECODENODEDISABLEDNODEENABLEDNODEFINITION
NODEFPWDNODEINIERRNODELIMTRNODELLOCK
NODENOTAVAILNODENOTCLUNODENOTMEMNODENOTPRES
NODERRNODESTQUENODETACHNODEVADAPNODEVAVL
NODEVICENODEXITNODIAGNOSENODIATONENODIRLISM
NODIRLISTNODISKQUOTANODSTQUENODTOOBIGNODUPEXC
NOELEMNOENCODENOENDNOENDOFLINENOENTRYSYM
NOCHARREADNOEOBSTRNOEOMNOEPMNOEXQUOTA
NOFIELDNOFILENOFILEACCESSNOFILEIDNOFILEROUTINE
NOFILESNOFILNAMNOFILPURGNOFORCMDNOFORMLARG
NOFREENOGBLNOGBLSECNOGBLSELDATANOGBLSELOWNER
NOGLOBALSNOGROUPNOGRPNAMNOGRPWILD
NOGSDREFNOHANDLERNOHDJMTNOHDRRESNOHIDDENNOHISTORY
NOHLPLIBSNOHLPTXTNOHOMENOHOMEBLKNOIDNAMNOIMGFIL
NOINDEXNOINDEXFNOINITNOINPFILESNOINPTABNOINSTRAN
NOINTABLENOIOCHANNOJOBCTXNOJOBIDNOJOBNAME
NOJOURNALNOKEYNOKEYMAPNOKEYMAPLIST
NOKEYWNOKFEFNDNOLASTVALNOLBLSNOLCLNOLICENSE
NOLINKNOLINKSNOLINXXXNOLISTNOLISTENERNOLITERAL
NOLOADNOLOCALSNOLOCKIDNOLOGNAMNOLOGTABNOLOWVER
NOMACFOUNDNOMALFUN1NOMALFUN2NOMATCH
NOMATCHESNOMATCHFOUNOMBXNOMCHKFRAME
NOMEMBERNOMODNAMNOMODSNOMORENOMORECHAR
NOMOREENTNOMOREFILENOMOREFILESNOMOREFORM
NOMOREITEMSNOMOREJOBNOMOREKEYSNOMOREMSG
NOMOREPROCNOMOREQUENO_MORMSGNOMP
NOMSGSNOMTCHENDMNOMTCHENDRNOMTCHFOU
NOMULTBKNONAMESNONANSICRTNONBRDMSGNONCONTIG
NONEDELNONEFOUNDNONERECNONETNONETMBX
NONEWMAILNONEXDRVNONEXISTNONEXISTBUFNONEXPR
NONEXSTACPNONLOCALNONODENONPHYSETNONPIC
NONPICDATNONPICIMGNONPICREFNONSMPDRV
NONSTDUNINONXTLINNOONE_ENABLEDNOOPCOMNOOPENJOB
NOOPERNOOPRNOOPRNDNOOUTPUTNOOUTQUALNOP1VA
NOPAGEDYNNOPARAMNOPARENNOPARENTNOPARMNOPASS
NOPASSWORDNOPATAREANOPENOPERATOR
NOPFNMAPNOPREDNOPREVNOPRINTNOPRIVNOPRIVDIRSUM
NOPRMCEBNOPRMGBLNOPRMMBXNOPROC
NOPROCESSNOPRODSNOPROTNOPSCTSNOPSWAPM
NOQFILENOQUALNOQUECTXNOQUESPACENOQUEUENOQUOTE
NORCPNORCVBUFNOREADNOREADCPNO_RECORDNOREDEFINE
NOREFNORELNOTENORELOCNOREMOTENORENDEV
NORENEXISTSNORENLOCKNOREPAIRNOREQNOREQSYM
NORESTARTNORETURNVALUENORIGHTSDBNORMAL
NORMAL_EXITNOROOMNORSTBLDNORTTBNORUNMCR
NOSAVESETNOSAVPEXCNOSCOPENOSCSNOSECEX
NOSELECTNOSENDBUFNOSERVERNOSERVERSNOSETPRV
NOSEVERNOSHDWMEMNOSHMBLOCKNOSHMEMNOSHMGSD
NOSHOWBUFNOSHRDNOSHRIMGNOSIGNALNOSLOTNOSOLICIT
NOSPACENOSRCHSTRNOSRCLINNOSTATSNOSTRINGNOSTRMEM
NOSUBEXINOSUCCNOSUCHACENOSUCHBPTNOSUCHCHAR
NOSUCHCPUNOSUCHCTXNOSUCHDEVNOSUCHELE
NOSUCHENTNOSUCHFILENOSUCHFORMNOSUCHJOB
NOSUCHLOCNOSUCHMEMNOSUCHMODNOSUCHMODU
NOSUCHNAMNOSUCHNODENOSUCHOBJNOSUCHPART
NO_SUCH_PARTYNOSUCHQUENOSUCHRMNOSUCHRQST
NOSUCHRTNNOSUCHRVNNOSUCHSECNOSUCHSERV
NOSUCHSYMNOSUCHTIDNOSUCHTPTNOSUCHUSER
NOSUCHUSRNOSUCHVERBNOSUCHWPTNOSUMM
NOSYMBOLNOSYMBOLSNOSYSACTNOSYSDISKNOSYSGBLNOSYSLCK
NOSYSNAMNOSYSPRVNOT1STVOLNOTACLUNOTALLPRIV
NOTALLSYMNOTANSINOTAPEOPNOTARRAYNOTASCIINOTASSIGN
NOTASTRUCTNOT_A_TERMNOT_A_TRMNOT_AVAILABLE
NOTBKBLOCKNOTBOOCAPNOTCLASSNOTCMPLTNOTCOM
NOTCOPIEDNOTCOP_RETRYNOTCREATORNOTCTX
NOTCURPCNOTDDBDDBNOTDECSTRGNOTDEFINABLE
NOTDELETEDNOTDIRNOTDISCONNOTDISKNOTDONE
NOTENABOPTNOTENUFOPRNOTERMNOTERMSNOTERRORKEYWORD
NOTFCBFCBNOTFCBWCBNOTFCPWCBNOTFILEDEV
NOTFOUNOTFOUNDNOTFRNOTFROMLATNOTGENDEV
NOTHENNOTHLPLIBNOTIDFMTNOTIDXNOTIFYNOTIMGLIB
NOTIMPNOT_IMPLNOTIMPLANNOTIMPLEMENTEDNOTIMPOPCODE
NOTINANIFNOTINITEDNOTINMACRONOTINPHYSNOTINSTALL
NOTINTBLSZNOTIRPAQBNOTJOURNALNOTLABEL
NOTLABELMTNOTLEARNINGNOTLGLISOPNOTLKB
NOTLOADEDNOTLOCKEDNOTMODNOTMODIFIABLE
NOTMODIFIEDNOTMOUNTEDNOTMPMBXNOTMTLMTL
NOTNEGNOTNETDEVNOTNUMBERNOTNUMCAP
NOTOBJLIBNOTODS2NOTONSCREENNOTORIGSRCNOTPARAM
NOTPASTEDNOTPATADRNOTPCBNOTPRINTED
NOTPSECOPTNOTPSECTNOTPTRNOTQUEUEDNOTQUO
NOTRACESNOTRANNOTREADINNOTRELVOLNOTRENAMED
NOTRESNOTRMSOUTNOTRULUCBNOTRVTVCB
NOTSAMEBUFNOTSAMEDEVNOTSAVEDNOTSAVESET
NOTSEQNOTSETNOTSHDWDEVNOTSHRIMGNOTSPLADDR
NOTSQDEVNOTSTARTEDNOTSTOPPEDNOTSTRCAP
NOTSTRUCT1NOTSYSTEMNOTUCBIRPNOTUCBRVT
NOTUCBUCBNOTUCBWCBNOTUICFMTNOTUQPORT
NOT_USABLENOTVALIDNOTVALLENNOTVCBUCB
NOTVOLSETNOTVVPVCBNOTWCBIRPNOTWCBWCB
NOTYETNOUNIQUENOUNLOADNOUPDATENOUSERNAMENOUSERPASS
NOUSERSPECNOUSRWCSNOVALATPCNOVALPRSNOVALU
NOVALUENOVECTORNOVERNOVIRMEMNOVOLDATANOVOLPRO
NOVOLUMESNOWATCHESNOWATTARNOWBPTNOWILD
NO_WINASSOCNOWINDOWNOWOPCONOWORLDNO_WRK
NOWRTNPKNSADDRNSFNTDNUDFENVSNUDFLSYMS
NUDFSYMSNULFILNULIDXNULLFILENULLPRINULLPRIVNULLSTRING
NULSAVESETNUMBERNUMELEMENTSNUM_KEYNUMOPRNDS
NUMTRUNCNUMVALNVROPRFAIOBJOBJLOCKED
OBSSERVERDBOBTEVTOCCLUDEDOCVNOTFNDODS2SAVE
OFFHOOKOFFLINEOK_ALKOK_DELOK_DUPOK_IDXOK_LIM
OK_NOPOK_RLKOK_RNFOK_RRLOK_WATOLDINSCHK
OLDLIBRARYOLDMISMCHOLDPURGEOLDTABOLDVALCHK
ONCOMDONDELRECLISTONEDELTIMONEENTQUE
ONEF11DEVONEF11OUTONEIMGDEVONELEARN
ONEPHYDEVONERRONESELECTONEVALONHOOK
ONLEVLONOVFOPCCUSOPCDECOPEFAIOPEJBCMBX
OPENBITMAPOPENDIROPENEXCOPENFDLOPENFILEOPENFOREIGN
OPENINOPENINDEXOPENMONOPENOUTOPINPROGOPENQUOTA
OPENUAFOPENVIRTUALOPER1OPER10OPER11OPER12
OPER2OPER3OPER4OPER5OPER6OPER7OPER8
OPER9OPERABORTOPERASSISTOPERFAILOPERREQ
OPERSPECOPERSTSOPINCOMPLOPNERROPNOTPERDOS
OPNOTSUPOPNOTPERF11OPNSNKOPRABORTOPREPLOPREPLY
OPRNDLNGOPRNDSYNXOPRNOTIFOPRQSTOPRQSTCAN
OPRQSTDONOPRSNDERROPSYNTAXOPTARGMIS
OPTIGNSHROPTIGNSYSOPTLINOPTSYNERROPTVALERR
ORDERORDER_ERRORORGOSCTOOLONOUTCMDLNG
OUTCONERROUTORDEROUTPUTOUTPUTLOSTOUT_RANGE
OUTSIMGOUTSIMGPOUTSTRTRUOUTSWPERROVERFLOW
OVERLAPRANGEOVERLAYOVERWRITEOVRALIOVRDSKQUOTA
OVRFLWOVRSIZPACTOOLONGPADPAGECRITPAGEFRAG
PAGEREDERRPAGEWRTERRPAGLIMEXCPAGNTRNVAL
PAGOWNVIOPAGRDERRPARENREQPARGTMTCHPARITY
PARMDELPARNOTGRANTPARSEPARSEERRPARSEFAILPARSEOVER
PARSTKOVRPARTCOPIEDPARTESCAPEPARTMAPPED
PARTOOBIGPART_SECTNPASALREXIPATERRPATHAMBIG
PATHLOSTPATHTLONGPATHUNDEFPATHUNRES
PATOVERPBDIN_USEPBFPC1PC2PC3
PDQUALERRPEAKUTILPENDINGPERMSYMPESPEXFULL
PFMBSYPFNLISTCNTPFNREFNZROPGFGBLBAD
PGFIPLHIPGFLOCBADPHANOTFNDPHYDEVGEO
PHYFILSPEPHYSETPLGPLVPOOLEXPFPORTRXERR
POSPOSERRORPOSITERRPOWERFAILPRACCREMPRACREN
PRCREATPREDEFREPPREMATUREEOFPREMEOFPREMMSG
PREPAREDPRESENTPREVDUPACEPREVINITPRIIHDBADPRIMIN
PRIMNOSTPPRIMOUTPRINTPRISECMAPPRIV
PRIVINSTALLPRMEOFPRMLENPRMLONPRMMSPRMNA
PRMRNGPROPROCDONEPROCESSENDPROCFILEPROCGONE
PROC_IDPROCINDEXPROCSUPERSEDEDPRODNOTINS
PRODSKIPPROERRPROFRANOTPROGLOSTPROL_WRT
PRONOTCHGPROTECTEDPROTERRPROTINSTALL
PROTMISPROTOCOLPROTOOLONPRTEXTPRVPRVNOTFND
PRVNOTUNQPRVVIOPSCALIPSCNXRPSECBUFOVF
PSECBUFUNDPSECOPCNFLPSTFULLPTELENVIOL
PTRCNTPURABOPURGEVERPURGWSSCNPUSSTAOVE
PUTERRPWDINDICPWDINHISPWDLOCKEDPWDNCHPWDNOL
PWDNOTDIFPWDNOTVALPWDNOTVERPWDSYNTAX
PWDWEAKPWFQEMPTYQFACTIVEQFNOTACTQIOBFOVFQIOERR
QSTQUALINVQUE_CLOSEDQUEFORMATQUENOTSTOP
QUERESETQUEUEMPTYQUITTINGQUOQUOTAFAIL
QUOTAFILERABRACRADRMODRATRAWFMT
RBFRCTUNRSZRRDBADDERRRDBADDERRU
RDBADDERRVRDBADDMSGRDBADDMSGURDBCREERR
RDBDONEMSGRDBMDFYERRRDBMDFYERRURDBMDFYMSG
RDBNOMODSRDBREMERRRDBREMMSGRDBREMMSGU
RDDELDATARDSNONRESREADABORTEDREADATTR
READBADREADBLOCKREADBMAPREADBOOTREADCHECK
READCHECKRECREADDIRREADERRREADERRRECREADERRS
READEVTREADFILEREADHEADERREADHOMEREADIMAP
READIBMAPREADJNLACEREADQUEHEADERREADQUOTA
READSBMAPREADSCBREADYREADREADYWRITE
READZEROREAJBCMBXREALLYQUITREALLYRECOVER
REBLDREQREBLDWARNREBOOTREBUILDRECGTRBLRECISDEL
RECLNGRECORDANSRECORDSWLRECOVERRECOVERABORT
RECOVERENDRECOVERFAILRECPRNRECTOBIGRECTOOBIG
RECTOOSMLRECTRUNCRECTYPRECURLEARNREDCACHE
REDEFSYMREDFLGERRREENTREENTERREENTRANCY
REFREFCNTNEGREFERENCEDREFRESH_NEEDED
REFUSEDREGOPSYNXREGWIDDUPREJECTRELCONCAT
RELINKRELMOVEDREMABOREMARCESTREMARCFAIL
REMARCNAVLREMARCSTSREMDEFREMDISABLED
REMENABLEDREMNOTENABREMERRREMMSGREMOINSF
REMOTEREMOUVOLREMOVEREMOVEDREMRSRCREMSYS
RENAMEDRENDEFRENMSGRENSYSREPEATREPLACEDREPLACEERR
REPLACERRREPLAYFAILREPLAYWARNINGREQDITEMMISS
REQFILMISREQKEYREQPRMABSREQUESTREQARGSMISSING
REQUIRESDECWREQUIRESTERMRERRESCRASHRESCRITICAL
RESDISMISSRESERRRESETRESETQUERESIGNALRESINFO
RESNOTDISKRESOKAYRESOPCODERESTARTCOM
RESTORERESTOREFAILRESTRICTRESULTOVFRESUME
RESUMEDRESUMEFAILRESUMEWARNRESWARNING
RETURNEDREVERSECASEREVOKEERRREVOKEMSG
REWINDREXRFARFAERRRFAPASTEOFRFLOC
RFMRHBRLFRLKRLSTMSGRLSSRVERR
RMALRDCLRMSRMSBUGRMSERRORRMSFILINIRMSFILMISRMV
RNAME_ABSENTRNAME_INVRNAME_LONGRNAME_ODD
RNFRNLROPROPRANDROUTREQRPCERRRPL
RPTCNTNABSRQSTABORTRQSTCANRQSTCMPLTE
RQSTDONERQSTPENDRQSTSTSTRRVRSARSBREFNEG
RSBREFNZRORSKRSLRSLOVFRS_LSS_AC
RSSRSTRSTERRRSV_ERRRSZRT11_BADDIRECT
RT11_BADFILERT11_BIGBADFILERT11_DIRSIZERT11_ERRLOCK
RT11_EXTRART11_NOENDRT11_OVERFLOWRT11_STBLOCK
RT11_TOOMANYBLKRT11_TOOMANYSEGRT11_UNKENTRTB
RTLRTNERRORRTOUTEOFRTPROTECTRTSRUCONFLICT
RUFRVN1NOTMTRVUSAMEDEVICESAMEFILE
SAVEAMBIGSYMSAVEERRORSAVEUNDEFPROCSAVSETCLU
SAVSETNAMSBIAERRORSCANADVANCESCANDEADPT
SCBRDERRSCHDWKSCRBUFOVFSCSSYSTEMIDSDBSFFULL
SDBSFRFAILSEARCHFAILSECINTFAISECOUTSECREFNEG
SECTBLFULSECTRESTOREDSECTSAVEDSECTUNDEFPROC
SEGSELRANGEZEROSEMALRMAXSEMANTICS
SEMININONSENDABORTSENDERRSENDFAILSEQSEQNCE
SEQUENCESEQUENCE2SERVE_ERRSERVEREXIT
SERVEXISTSSETIMRSETKEYSETLIMITSETMAXSETMIN
SEVINVALDSHARCONFSHMGSNOTMAPSHMNOTCNCTSHOFIL
SHOIOSHORTBLOCKSHORTDUMPSHOW_ERR
SHOWERRSHRSHRCNTNEGSHRCPYIGNSHRIDMISMAT
SHRINSYSSHRPSCLNGSHRPSCREFSHRSEPCLU
SHRSYMREFSHRSYMTRASHUTSHUTDOWN
SIGNO_ARGSIZSIZETRUNCSKCSKPDATSLOWRESP
SMALLPAGESOFTRERRSSOFTWERRSSOLCONNECT
SOLOPENSOLREADLINESOLTIMEOUTSOLWAITING
SORTALLOCMEMSOURCELINESPAWNEDSPCIVCSPCIVD
SPCIVFSPCIVISPCIVKSPCIVPSPCIVSSPCIVXSPCMIS
SPCOVRSPCSISSPDNOTSETSPECDEVSPECDIRSPECIFY
SPECNODESPECWILDSPLSPLACQERRSPLRELERR
SPLRSTERRSPLIPLHIGHSPLIPLLOWSPNAMLNGSPTERRS
SPTFULLSPTNOTFNDSPWNIOSQOSQUALERRSQUROONEG
SRCLINSRCLINNOTSRCMEMSRTIWASRVALLOAD
SRVMISMATCHSSCHANGESSERRORSSFAILSSRSSRVEXCEPT
STABLEEXCSTACKDUMPSTACKOVERSTALITUDF
STARTDELETESTARTEDSTARTRECORDSTARTVERIFY
STASMALLMEMSTATENTSVDSTATE_UNKSTATOOLONG
STDSTDISPICSTEPINTOSTGTRUNCSTILLKEYSSTKOVFSTKOVFLO
STMRECFMTSTNOTAVAILSTOPPEDSTPCLUSTPINVALD
STRCPYERRSTRIS_INTSTRLVLSTRNGPADSTRNOTFOUND
STRNOTWCBSTRTERESCSTRTNOMULTISTRTOOLARGE
STRTOOLNGSTRTOOLONSTRTRUSTRUCLEVSTRUCSIZE
STRUCT_LEVELSUBABORTSUBALREXISUBINTERRSUBLOCKS
SUBMITERRSUBOUTBNDSUBRNGSUBSCHERR
SUBSTRINGSUBSPNERRSUBSTSERRSUBTRACED
SUCCDUPACESUCCESSSUPSUPERSEDESUPPORT
SUSPENDSUSPENDEDSWAPAGINSSWAPWSLESYITSTERR
SYMABRSYMCREPRCSYMDCLEXTRSYMDEFINMO
SYMDELSYMDELETESYMINSERTSYMLNGSYMNAMLNG
SYMNOTABSSYMNOTACTSYMNOTFOUSYMOUTPHAS
SYMOVFSYMREPLACESYMTOOLNGSYMTOOLONG
SYMTRUNCSYNSYNCHSYNERRSYNTAXSYNTAXERR
SYNTAXERRORSYSSYSADJWSLSYSBOOT-F-FBIC
SYSDEVSYSDIRSYSDISKSYSERRORSYSERRORPCSYSERROR[[PC]]
SYSFAILSYSFAOERRSYSIDSYSJNLFULLSYSJNLNAC
SYSLOADSYSMGTSYSMSG2SYSNAMSYSNOTUPDSYSPWDMOD
SYSSRVERRSYSTRMERRSYSVERCHKSYSVERDIFSZTOOBIG
TABEXISTTABID_MISTABLEFULLTABNOTFNDTABSUPER
TAMPERTAPECLASSTAPEFULLTAPEPOSLOSTTAPESTAR
TBITTBKBUGTERMDSBLTERMENABTERMFAILTEROUTTEXT
TEXTDTFETFRSYSTHIRDPARTYTIMEOUTTIPCUFLOW
TIRLNGTIRNYITITLETITLETRUNCTKNOVFTLKINUSE
TMFTMOTMPTMPMBXTMRTMSTMT
TMVTNSTOODEEPTOOFEWTOOLONGTOOMANCLS
TOOMANDISTOOMANERRTOOMANNODTOOMANPAS
TOOMANYTOOMANYARGSTOOMANYCOLTOOMANYLEV
TOOMANYLNAMTOOMANYPARAMTOOMANYREDSTOOMANYVER
TOO_MNYTOOMNYARGTOOMNYARGSTOOMNYDLM
TOOMNYENDRTOOMNYFILTOOMNYFILESTOOMNYGST
TOOMNYLIBTOOMNYOPNDTOOMNYOUTTOOMNYPSEC
TOOMUCHDATATOPLINETRUNCTOQUITTOTALTRACEBACK
TRACIGNTRETRMMBXTRMNOTANSTRUTRUNC
TRUNCATETRUNCATEDTRUNCDATTSTPHSNAMTTL
TWICETWOWIDTHSTYPTYPMISMCHUAEERR
UAFGETERRUAFOPNERRUBFUBMAPEXCED
UDAPORTUDEFPSCUDF_BKSUDF_BLKUDFENVUDFSYMUDS
UICERRUID_INVUID_LENGTHUKNFACILITYUME
UNABLCREVAUNABLEUNAOPNHLPUNAOPNSRC
UNAREASRCUNARYOPERUNASEFCUNDEFINEDPROC
UNDEFLINKUNDEFOUTPUTUNDEFSYMUNDEFSYNTAX
UNDEFTYPEUNDEFXFRADUNDEXPUNDFILUNDKEY
UNDOPTIONUNDSYMUNDTERNAMUNDTERNOP
UNDTERNOSUNDTERTYPUNDWIDCLAUNECLIERR
UNEXPECTEDUNEXPERRUNEXPEXCUNEXPIOINTUNINITVAR
UNIVSTARUNKADAPUNKCLASSUNKCPUUNKDEVUNKENTRYUNKESCAPE
UNKESCSEQUNKKEYWORDUNKMSGUNKNFAILUNKNOPR
UNKNOWNCLEARINGHOUSEUNKNOWN_TAGUNKNPRQUNKOBJECT
UNKOPCODEUNKPKTFMTUNKREPLYUNKRSTRTUNKTYPE
UNKWNDESCUNLKVOLUNLOCKEDUNLOCKERRUNMTCHPARN
UNPRIKWUNPROPARMUNPROQUALUNQUAKWUNRCMD
UNRCMPUNREACHABLEUNRECSTAUNRECSTMTUNRELVOL
UNRFORCODUNRFUNUNRKEYUNRPTYUNSAFEUNSECKW
UNSOLICITUNSTLEVUNSUPRTCPUUNSVRSUNTERMARG
UNTERMCONDUNWINDUNWINDINGUNXINTEXC
UNXPCTSTSUNXSIGNALUPDATEUPDATEDUPDURTRAV
UPIUREURRUSCALLUSEANSUSEFLORES
USERDSABLUSERQSTUSERSPECUSERVALUSEUDFEN2
USEUDFENVUSEUDFLSYUSEUNDEFUSEUNDEF2
USGOSUBUSGOTOUSRINPERRUSRTFRUSZV2COMP
VALERRVALNOTADDRVALPRIVALREQVALTOOBIG
VALUEVARITHVASFULVASOVFVBNERRORVBNMAPFAIL
VBNMISSINGVBNPASTEOFVCALNORCVVECALIGN
VECCTXERRVECDISVECEMULTRVEC_FLOOVEMAT
VEC_FLOUNDMATVECFULLVECINUSEVEC_INVARGMATVEC_LOGZERNEG
VEC_SQUROONEGVECTORVEC_UNDEXPVERVERBNOTFND
VERIFYERRVERIFYICFVERS_MISMATCHVETOVFC
VOIALREXIVOLALRMNTVOLIDENTVOLINSETVOLINVVOLMOUNT
VOLNAMEVOLOERRVOLSETSTSVOLSHDWMEMVOLSTATUS
VOLUME_FULLWACKQEMPTYWAITERRWAITIDLEBCB
WANTOSENDWARNINGWARNISUEWASECCWBEWCBFCBMNG
WCCWCSCORRWDW_MAXPREVWDW_MAXPRMWER
WFRWIDMISMATCHWILDCONCATWILDOVTVER
WILUSERMSWINDNOTMAPPEDWINDNOTVISWINEXISTS
WINKWINTRUNCFITWKQERRWLDWLDNOTALWD
WLKWORK_DEVWORKSTACMDWPLWPTTRACE
WRIRSPMSGWRISMBMBXWRITEACTWRITEATTR
WRITEBACKWRITEBLOCKWRITEBOOTWRITECHECK
WRITECHECKRECWRITECURWRITEERRWRITE_ERRWRITEERRREC
WRITE_FAILEDWRITEFILEWRITEHEADERWRITEHOME
WRITEIBMAPWRITE_INTO_KERNELWRITE_INTO_KERNEL_STACK
WRITEJNLACEWRITELOCKWRITEMONWRITENABLE
WRITERRSWRITESBMAPWRITESCBWRITLCKWRNERSWRONGACMODE
WRONGACPWRONGDATASETWRONGOWNERWRONGSTATE
WRONGVOLWRONUMARGWRTEVTWRTFILWRTHOMBLK
WRTINVBUFWRTINVHDRWRTPGSBAKWSLENOVAL
WSLPAGCNTWSLVANVALWSLXVANMATWSSIZEERR
XABXNFXORERRSXQPERRYESYESNOZEROLEN
ZEROPAGE

Advance past bottom of buffer’AS’ requiredBIIC failure-BICSR/BER/CNF ’xxxxxxxx/xxxxxxxx/xxxxxxxx’
BVP failure-Status/Error/Data ’xxxxxxxx/xxxxxxxx/xxxxxxxx’BVP timeout-Status/Error/Data ’xxxxxxxx/xxxxxxxx/xxxxxxxx’
Cannot set terminal type from change modeError opening terminal for input
Error opening terminal for outputError reading from input fileError reading from terminal
File specification requiredMicro-code Verification ErrorNo Path-Block During Virtual Circuit Close
Parallel Path is Closing Virtual Circuit-REMOTE PORT ’xxx’Port Error Bits Set-CNF/PMC/PSR ’xxxxxxxx/xxxxxxxx/xxxxxxxx’
QUEisEMPSYSBOOT-F-Invalid console IDSYSBOOT-F-Microcode revision level too low to boot
SYSBOOT-F-Not enough nonpaged pool to mapSYSBOOT-F-Pageable system space exceeds 512 MB
SYSBOOT-F-PFN allocation overwrites CI ucodeSYSBOOT-F-PFN bit map conflict-Physical page count set too low
SYSBOOT-F-SystemSYSBOOT-F-Unable to allocate physical memorySYSBOOT-F-Unable to allocate PTEs for Boot Driver
Unexpected Interrupt-CNF/PMC/PSR ’xxxxxxxx/xxxxxxxx/xxxxxxxx’Unrecognized command
Unrecognized command option

AAA

'filespec'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This message should never be displayed.

   User Action: Submit a Software Performance Report (SPR).

ABEND

'string' aborted

   Facility: Shared by several facilities

   Explanation: A program phase terminated prematurely.

   User Action: None.

ABENDD

'string' aborted at 'date'

   Facility: Shared by several facilities

   Explanation: A program phase aborted prematurely.

   User Action: None.

ABENDT

'string' aborted at 'time'

   Facility: Shared by several facilities

   Explanation: A program phase aborted prematurely.

   User Action: None.

ABFNAM

ambiguous lexical function name-supply more characters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Too few characters were used to truncate a lexical
   function name to make the function name unique.

   User Action: Reenter the command; specify at least four characters
   of the function name.

ABKEYW

ambiguous qualifier or keyword-supply more characters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Too few characters were used to truncate a keyword or
   qualifier name to make the keyword or qualifier name unique.

   User Action: The rejected portion of the command is displayed
   between backslashes (\ \). Reenter the command; specify at least
   four characters of the keyword or qualifier name.

ABKW

ambiguous keyword in statement 'number '<CRLF>'reference-text'

   Facility: FDL, Edit/FDL Utility and FDL, Create/FDL Utility

   Explanation: You have used an ambiguous abbreviation for an
   attribute keyword.

   User Action: Enter a more specific abbreviation.

ABNORMAL_EXIT

abnormal exit

   Facility: PPL, Parallel Processing Facility

   Explanation: This code indicates the occurrence of the abnormal
   participant termination event.

   User Action: Since the application requested this notification,
   your response is application-dependent.

ABORT

'testname' aborted at 'date' or 'time'

   Facility: UETP, User Environment Test Package

   Explanation: A test ended abnormally.

   User Action: Investigate the reason for the abnormal termination
   of the test. Take corrective action based on the accompanying
   message.

abort

   Facility: SYSTEM, VMS System Services

   Explanation: An attempted operation is aborted by the $CANCEL
   system service.

   o  An I/O request is canceled before it is completed.

   o  Following a network request, this status indicates that a
      logical link is disconnected.

   o  A fatal hardware error occurred.

   User Action: The operating system does not normally display this
   message. User programs should be coded to detect and respond
   to the status return. If this message is associated with a
   status code returned by a request to a DMP11 interface, examine
   the device-dependent longword in the IOSB to determine if the
   controller is dead. (The controller is dead if the XM$V_ERR_FATAL
   bit is set.) If the controller is dead, restart the controller.
   Next, check if the tributary is dead. (The tributary is dead
   if the SM$V_STS_ACTIVE bit is clear.) If the tributary is dead,
   restart the tributary.

abort

   Facility: SYSTEM, VMS System Services

   Explanation: The transaction aborted during processing.
   Transactions may be aborted because: a resource manager vetoed
   the transaction; a user program issued the $ABORT_TRANS service; a
   DECdtm processing error was encountered.

   User Action: If the transaction was aborted as the result of
   a specific system service call by a resource manager or user
   program, no user action is necessary. If the transaction aborted
   for any other reason, contact the system manager.

abort

   Facility: SYSGEN, System Generation Utility

   Explanation: This message is issued with other messages to
   indicate that the action is aborted.

   User Action: Take corrective action based on the accompanying
   messages.

operator requested abort on fatal error

   Facility: BACKUP, Backup Utility

   Explanation: In response to a BACKUP-I-SPECIFY prompt, the user or
   operator entered the QUIT option; the Backup Utility terminates.

   User Action: None.





ABORTC

'testname' to abort this test, type CTRL/C

   Facility: UETP, User Environment Test Package

   Explanation: The image displaying this message responds to CTRL/C
   by terminating gracefully (deassigning all logical names and
   deleting all files) and passing control to the command language
   interpreter. You cannot restart the image after pressing CTRL/C.
   Use CTRL/Y to temporarily interrupt an image.

   User Action: None.

Aborted by CTRL/C

   Facility: EDT, EDT Editor

   Explanation: You pressed CTRL/C after entering a command in keypad
   change-mode. Pressing CTRL/C causes all text to disappear from the
   screen.

   User Action: If the text is not restored to the screen, press
   RETURN.

ABPRIKW

ambiguous primary keyword in statement 'number'<CRLF>'reference-
text'.

   Facility: FDL, Create/FDL Utility

   Explanation: You have used an ambiguous abbreviation for an
   attribute keyword.

   User Action: Provide a more specific abbreviation.

ABSENT

entity or value absent from command string

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This status is returned by the CLI$PRESENT CLI
   interface routine. This indicates that the entity value has not
   been specified in the command line.

   User Action: None.

ABSTIMREQ

absolute time required, delta time supplied

   Facility: LIB, Library Facility

   Explanation: A delta time is passed to the routine when an
   absolute time is required.

   User Action: Examine each argument and change the delta time to an
   absolute time.

ABSYMD

abbreviated symbol definition conflict-rename symbol

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A new abbreviated symbol is ambiguous with an
   existing symbol. The new symbol is not entered.

   User Action: Display the current symbols and adjust the
   abbreviation of the ambiguous symbol.

ABVERB

ambiguous command verb-supply more characters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Too few characters were used to truncate a command
   name to make the command name unique.

   User Action: Reenter the command; specify at least four characters
   of the command name.

ACC

ACP file access failed

   Facility: RMS, VMS Record Management Services

   Explanation: An error occurred during an attempt to open a file.
   This message is associated with a status code returned from a file
   system ACP QIO request made by VMS RMS.

   User Action: The status value (STV) field of the FAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.

ACCADDCOM

access violation in address computation for 'address-value'

   Facility: DEBUG, VMS Debugger

   Explanation: The address computation for the specified variable
   resulted in an access violation. This normally means that a
   register value or a descriptor needed in the address computation
   is uninitialized or corrupted.

   User Action: If the necessary register or descriptor is not yet
   initialized, the variable is not available at this point in the
   code. If the register or descriptor is corrupted, the cause of
   this error should be located and corrected.

ACCCIR

access control specified with loop circuit

   Facility: NCP, Network Control Program

   Explanation: Access control with a LOOP command may be specified
   only with a LOOP NODE or with a LOOP EXECUTOR command, not with a
   LOOP CIRCUIT command.

   User Action: Reenter the LOOP CIRCUIT command without the access
   control.

ACCDISERR

accounting disabled due to file errors

   Facility: JBC, Job Controller

   Explanation: Accounting has been disabled because of previously
   reported errors in the accounting file.

   User Action: Correct the condition that caused the errors, and
   reenable accounting with the SET ACCOUNTING/ENABLE command.

ACCERR

nonblank accessibility field in volume labels on 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: The accessibility field on the magnetic tape, which
   is mounted on the device indicated, has a nonblank accessibility
   field. This field denies access to the tape.

   User Action: Mount the magnetic tape with the
   /OVERRIDE=ACCESSIBILITY qualifier. (The user must be the owner
   of the volume or have VOLPRO privilege.)

ACCESSFAIL

access has failed for 'device-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility is unable to access the named
   device. A second error message should follow the ACCESSFAIL
   message, giving more information.

   User Action: Retry the command, after taking corrective action
   suggested by the second line of the message.

ACCLIN

access control specified with loop line

   Facility: NCP, Network Control Program

   Explanation: Access control information may be specified only with
   the LOOP NODE or LOOP EXECUTOR commands, and not with the LOOP
   LINE command.

   User Action: Reenter the LOOP LINE command without the access
   control.

ACCONFLICT

'filename' is open for write by another user

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility opened the specified file while
   another user is writing the file because the /IGNORE=INTERLOCK
   qualifier is specified with the DCL command BACKUP.

   User Action: Note that the saved copy of the file may be
   inconsistent.

file access conflict

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt to access a file failed because the type
   of access requested conflicted with the current file access. This
   message is also returned when an execute-only shareable image is
   referenced in the context of a main program that is not installed
   with the /EXECUTE_ONLY qualifier.

   User Action: Possible actions include the following:

   o  Establish who opened the file and wait until it is closed.

   o  Check for a programming error. Begin debugging procedures to
      verify the type of problem and to find a method to correct it.

   o  Install the main program with the /EXECUTE_ONLY qualifier.


ACCOUNT

this installation creates an account named 'account-name'

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product being installed (or updated) has created
   an account with the specified name. The user authorization file
   (SYSUAF) has been updated accordingly.

   User Action: None.

ACCQUOTA

ACCOUNT had inadequate quota at remote node

   Facility: SYSTEM, VMS System Services

   Explanation: This error message is associated with a status
   code returned from a system service request. An attempt is made
   to initiate a DECnet-VAX logical link connection. The target
   object is already using its quota of logical links or some other
   resource.

   User Action: This condition is not usually permanent. Try
   initiating the connection later. Consult the VMS Networking Manual
   for additional information.

ACCVIO

access violation, reason mask = xx, virtual address = location, PC =
location, PSL = xxxxxxxx

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: An image attempted to read from or write to a memory
   location that is protected from the current mode. This message
   indicates an exception condition and is followed by a register and
   stack dump to help locate the error. The reason mask is a longword
   whose lowest three bits, if set, indicate that the instruction
   caused a length violation (bit 0), referenced the process page
   table (bit 1), attempted a read/modify operation (bit 2), was a
   vector operation on an improperly-aligned vector element (bit 3),
   or was a vector instruction reference to an I/O space address (bit
   4).

   This message is also displayed when an attempt has been made to
   make the user stack larger than the user's virtual address space
   permits. For example, the automatic user stack expansion algorithm
   reports an access violation with the following two conditions
   which should serve as hints that automatic expansion has failed:

   o  The reason mask has the low-order bit set. This indicates a
      memory reference which is not described in any page table.

   o  The relatively small P1 address space virtual address is
      referenced.

   User Action: Examine the PC and virtual address displayed in the
   message. The virtual address is often the address to which the
   access attempt was made. However, in the case of vector-related
   access violations and in some processor implementations, the
   reported virtual address may be some other address in the same
   page as that address to which the access was attempted. Check the
   program listing to verify that instruction operands or procedure
   call arguments are correct.

   If this message is displayed because of insufficient virtual
   memory for automatic user stack expansion, reduce the user stack
   requirements of the image or increase the virtual address space
   available to the process in which the image is executed.

access violation, reason mask='xx', virtual address='xxxxxxxx',
PC='xxxxxxxx', PSL='xxxxxxxx'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Internal VAXTPU failure.

   User Action: Please submit a Software Performance Report (SPR).


AC_LSS_MP

ACOFFSET field less than MPOFFSET

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: This message is issued along with the BADHEADER
   message and gives a more detailed reason why the specified file
   header is corrupt. In this case, the Access Control List Offset
   field of an ODS-2 header (FH2$B_ACOFFSET) contains a value less
   than the Map Area Offset field (FH2$B_MPOFFSET), wrongly implying
   that the Access Control List precedes the Map Area in the header.

   User Action: None. See the BADHEADER message.

ACPMBFAIL

ACP failure to read mailbox

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all physical memory is
   written to a system dump file, the system automatically
   reboots if the BUGREBOOT system parameter is set
   to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ACPNAME

ACP file name is too long

   Facility: MOUNT, Mount Utility

   Explanation: The file name specified for an ACP image has more
   than nine characters.

   User Action: Reenter the command and specify the correct ACP file
   name.

ACPRECURS

attempted recursion in ACP secondary operation

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ACPSHO

an error is returned from a NETACP SHOW function

   Facility: EVL, Event Logger

   Explanation: A network SHOW function used to obtain database
   information from the network returned an unexpected error. This
   could be caused by a software error.

   User Action: Submit a Software Performance Report (SPR).

ACPTIME

ACP does not respond

   Facility: MOUNT, Mount Utility

   Explanation: The ACP that is requested in the DCL command MOUNT
   cannot be initialized. Either the specified image is not an ACP or
   a system error has occurred.

   User Action: Verify that the image is an ACP. If it is an ACP,
   consult your system manager to determine what events in the system
   might prevent the ACP from starting.

ACPUNSTAK

attempted unstack in ACP primary context

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ACPVAFAIL

ACP failure to return virtual address space

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ACPVAFUL

MTAACP's virtual address space is full

   Facility: SYSTEM, VMS System Services

   Explanation: Additional volumes cannot be serviced by the ACP
   because it does not have enough memory to allocate control
   information for a new volume.

   User Action: Start a different ACP using the /PROCESSOR qualifier
   with the DCL command MOUNT.

ACS

error in access control string

   Facility: RMS, VMS Record Management Services

   Explanation: The access control string in the file specification
   is invalid. Either too many characters or too many subfields were
   specified.

   User Action: Correct the syntax of the access control string and
   retry the operation. Limit the number of characters to 42 (not
   including quotation marks) and the number of subfields to 3.

ACSIGN

access control string ignored

   Facility: REM, Set Host Facility

   Explanation: The access control string specified on a SET HOST
   command is ignored by the remote terminal facility.

   User Action: None.

ACT

file activity precludes operation

   Facility: RMS, VMS Record Management Services

   Explanation: An RMS operation is attempted while other RMS
   activity is in progress. This can occur when a record or file
   operation is attempted while that record stream or file has
   an operation in progress. It may also indicate that a record
   operation was attempted while a file operation was active, or a
   file operation was attempted while a record operation was active.

   User Action: Correct the program logic to avoid conflicting
   concurrent operations.

ACTIVE

the following processes are still active:

   Facility: VMSINSTAL, Install Procedures

   Explanation: When VMSINSTAL begins an installation, it makes
   sure that no user processes are active. This check has failed.
   VMSINSTAL lists active processes.

   User Action: The Install Utility asks you if you want to continue
   the installation. DIGITAL recommends that you correct this
   situation before continuing.

ACTIVEBCB

buffer active during reel switch

   Facility: BACKUP, Backup Utility

   Explanation: A software error occurred in the Backup Utility.

   User Action: Submit a Software Performance Report (SPR).

ACVINORCV

expected access violation exception not received

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error while testing a vector processor's ability to
   generate memory management exceptions.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

ADDERR

unable to add user record

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.

ADDFIL

error adding file 'filename' to job

   Facility: PRINT, PRINT Command and SUBMIT, SUBMIT Command

   Explanation: The system encountered an error adding the specified
   file to a batch or print job. The accompanying message provides
   additional information.

   User Action: Correct the error and reenter the command.

ADDFILE

error adding file 'file-name' to job 'job-name' for user 'user-name'
in queue 'queue-name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error occurred during a $SNDJBC system service
   call attempting to add a file to the job The file was not restored
   to the job list during the upgrade.

   User Action: The accompanying message gives information why the
   operation failed. Correct the problem and retry the upgrade,
   or after the upgrade has completed, print or submit the file as
   originally desired using the DCL command PRINT or SUBMIT.

ADDMSG

user record successfully added

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is informational.

   User Action: None.

ADDQUOTA

error adding quota record for ['uic']

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to add an entry to the quota file for the specified UIC.
   The accompanying message provides additional information.

   User Action: Correct the condition specified in the accompanying
   message and reenter the Verify Utility command line.

ADDRANCOV

address range covers more than one module 'address-value' is in
'path-name' 'address-value' is in 'path-name'

   Facility: DEBUG, VMS Debugger

   Explanation: The address range specified in an EXAMINE/SOURCE
   command covers more than a single module. This is not allowed. The
   start address xxx is in module mod1 and the end address yyy is in
   module mod2.

   User Action: Reenter the command with a valid address range.

ADJSCROLLREG

scrolling parameters altered to top: 'top', bottom: 'bottom',
amount: 'amount'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The window you have just adjusted is not big enough
   to handle the current scrolling region, so the scrolling region
   has been altered.

   User Action: None.

ADRLSTSYNX

address list syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The address list in the .ADDRESS directive contains a
   syntax error.

   User Action: Correct the syntax.

ADRWRTDAT

address data in shareable writeable section in psect 'psect-name'
offset 'number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The object language equivalent of the VAX MACRO
   .ADDRESS directive is encountered in a COMMON section, such as
   those found in VAX BASIC, VAX FORTRAN, or VAX PL/I. This would
   cause the section to be nonshareable; so the linker bases the
   image.

   User Action: Remove the address data from the command and
   initialize it at run time.

Advance past bottom of buffer

   Facility: EDT, EDT Editor

   Explanation: You attempted to move the cursor past the end of the
   buffer ([EOB]).

   User Action: Press the up arrow key to move the cursor above the
   [EOB] mark.

ADVADVCOMP

device error while advertising

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred on the network device while
   advertising clearinghouse information.

   User Action: The device in which the error occurred is included in
   the error text, along with the VMS status from the device. Take
   corrective action based on the accompanying VMS error message.

ADVADVERSEND

multicast error while advertising clearinghouse

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process was unable to build an
   advertisement protocol or send the protocol via multicast.

   User Action: This error should only be seen on systems that
   contain a DNS server. Stop the server and restart it. If
   the problem persists, contact your DIGITAL field service
   representative.

ADVALLOC

failed to allocate space for cache entry

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: There is not enough room in the DNS clerk cache for a
   namespace nickname. The namespace will not be added to the clerk
   cache.

   User Action: None.

ADVBADFORMAT

bad advertisement message received from device

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The message that the DNS$ADVER process read from the
   network device was an invalid clearinghouse advertisement.

   User Action: Make sure no other process is using multicast ID
   numbers 09-00-2B-02-01-00 and 09-00-2B-02-01-01. If not, check
   that the multicasting device is operating correctly.

ADVBTIM

error converting time string in $BINTIM

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An internal error occurred in the DNS$ADVER process.
   The image might be corrupt.

   User Action: Submit a Software Performance Report (SPR).

ADVCACHEINIT

could not initialize DNS clerk cache

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process was unable to initialize the
   DNS caches. This message is usually accompanied by a message
   indicating the reason for the failure.

   User Action: Make sure no other DNS$ADVER process is running
   on the system. Also, make sure that the DNS$CLIENT or DNS$SHARE
   executables are not installed as shareable images. Take corrective
   action based on the accompanying VMS error message.

ADVCANTIM

error canceling multicast timer

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process was unable to cancel a local
   timer (used to determine when a multicast of local DNS server
   information is performed).

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVCHUID

failed to add clearinghouse to cache

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while trying to add DNS
   clearinghouse information to the DNS global cache. The actual
   DNS error that caused this error accompanies this error message.
   The clearinghouse will not be entered in the global cache.

   User Action: None.

ADVCLILOADFAIL

error while loading client clearinghouses

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while the DNS$ADVER process
   attempted to load clearinghouse information into the client cache.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVDEASGN

error deassigning device

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process was unable to deassign a device
   that was no longer needed.

   User Action: The device in which the error occurred is included in
   the error message, along with the VMS status from the device. Take
   corrective action based on the accompanying VMS error message.

ADVDEFCONN

error connecting DNS$DEFAULT_FILE.DAT, no default namespace defined

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process was able to open the
   configuration file, but was unable to connect to the file and
   read it.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVDEFLOAD

error closing DNS$DEFAULT_FILE.DAT

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process was unable to close the
   configuration file.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVDEFOPEN

error opening DNS$DEFAULT_FILE.DAT, no default namespace defined

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process was unable to open the file
   containing configuration information for this system. The DNS
   clerk can still execute, but names that use default namespaces
   will be marked invalid.

   User Action: Make sure the file DNS$DEFAULT_FILE.DAT exists
   in the SYS$SYSTEM directory. If it does not, then use the
   SYS$STARTUP:DNS$CHANGE_DEF_FILE.COM command file to configure
   default information for the local system. If the file does exist,
   make sure it has WORLD readable protection.

ADVDEFPARSE

error parsing DNS$DEFAULT_FILE.DAT, no default namespace defined

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: One or more of the entries in the DNS configuration
   file was invalid. The advertiser was unable to determine the
   default namespace.

   User Action: You may need to edit the configuration file
   DNS$DEFAULT_FILE.DAT in SYS$SYSTEM so it only contains
   configuration information for the DNS clerk. You can reconfigure
   the system using the SYS$STARTUP:DNS$CHANGE_DEF_FILE.COM command
   file. After making corrections, stop the DNS clerk (using
   SYS$STARTUP:DNS$CLERK_STOP.COM) and then restart it (using
   SYS$STARTUP:DNS$CLERK_STARTUP.COM).

ADVDEVCHECK

error checking ethernet devices

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while checking the status of a
   network device.

   User Action: The device in which the error occurred is included in
   the error text, along with the VMS status from the device. Take
   corrective action based on the accompanying VMS error message.

ADVDUMPFAIL

error while dumping DNS server clearinghouses

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while the DNS$ADVER process
   attempted to create a configuration file on the local system.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVETHERMEM

no memory for write to device

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: There is not enough memory available for the
   DNS$ADVER process to allocate space to build a protocol.

   User Action: Check process and system memory quotas.

ADVMBX

could not create mailbox DNS$SOLICIT_MBX

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred on the local system that prevented
   the DNS$ADVER process from creating the DNS$SOLICIT_MBX mailbox.
   This mailbox is used by the DNS clerk to log errors.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVNICKUID

failed to add NICKNS entry to cache

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while trying to associate a UID
   with a namespace nickname in the DNS global cache. The actual DNS
   error that caused the error is included in the error message. An
   entry will not be made in the global cache for this namespace.

   User Action: None.

ADVPRIV

not enough privs to run DNS$ADVER

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The process executing the DNS$ADVER process does not
   have the necessary privileges.

   User Action: The DNS$ADVER process needs SHMEM, PFNMAP, EXQUOTA,
   PRMGBL, SYSGBL, SYSLCK, SYSPRV, LOG_IO, NETMBX, TMPMBX, SYSNAM and
   CMKRNL privileges. Restart DNS$ADVER using these privileges.

ADVRANDOM

error generating random number

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: Random numbers are used by the DNS$ADVER process to
   help prevent congestion of multicasts on the network.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVRECBUF

device error while receiving message

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process encountered an error while
   receiving a message through the network.

   User Action: The device in which the error occurred is included in
   the error text, along with the VMS status from the device. Take
   corrective action based on the accompanying VMS error message.

ADVRECREATE

recreation of mailbox DNS$SOLICIT_MBX failed

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while receiving a message on the
   mailbox. Another error occurred when the DNS$ADVER process tried
   to remedy the error by recreating the mailbox.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVREREAD

re-read of DNS$SOLICIT_MBX failed

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while receiving a message on
   the mailbox. After a new mailbox had been successfully created,
   another error occurred while trying to reread the mailbox.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVSETIMR

error setting timer for multicasts

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process was unable to set a local
   timer. This timer is used to determine when a multicast of local
   DNS server information is performed.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVSOLCOMP

device error while soliciting DNS servers

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process encountered an error while
   multicasting a solicitation message to DNS servers on the network.

   User Action: The device in which the error occurred is included in
   the error text, along with the VMS status from the device. Take
   corrective action based on the accompanying VMS error message.

ADVTIMERR

cannot create timeout value

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS$ADVER process attempted to create a DNS
   timeout value, but received an error from the $GETTIM service
   routine.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

ADVUIDNICK

failed to add NSNAME entry to cache

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while trying to associate a UID
   with a namespace nickname in the DNS global cache. The actual DNS
   error that caused this error is included in this error text. No
   entry will be made in the global cache.

   User Action: None.

ADVWRITETHER

error writing on device

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: An error occurred while DNS$ADVER was trying to write
   to an Ethernet device.

   User Action: The device in which the error occurred is included in
   the error text, along with the VMS status from the device. Take
   corrective action based on the accompanying VMS error message.

AGAIN

another data analysis pass is needed

   Facility: DCX, Data Compression/Expansion Utility

   Explanation: This status, returned by DCX$MAKE_MAP, indicates that
   DCX must see all data records again before it can compute a map.

   User Action: The application program should again present data to
   DCX for analysis.

AID

invalid area id = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: An allocation XAB for a $CREATE, $DISPLAY, $EXTEND,
   or $OPEN operation contains an invalid area identification number
   field.

   User Action: The status value (STV) field of the FAB provides the
   area identification value in error. Verify that the call to the
   VMS RMS service is coded correctly.

ALCPHD

allocate process header error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ALCSMBCLR

ACP tried to allocate space already allocated

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ALI

invalid alias identification

   Facility: NCP, Network Control Program

   Explanation: The format of the alias indentifier is incorrect.

   User Action: Check the syntax rules for alias identifiers and
   reenter your command with the correct alias identifier.

ALIGNDISK

'device-name' contains an alignment cartridge

   Facility: BAD, Bad Block Locator Utility

   Explanation: The device specified contains an alignment cartridge.

   User Action: Replace the cartridge with a data cartridge and
   reinvoke the utility.

ALIGNXCEED

alignment exceeds PSECT alignment

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The .ALIGN directive specified an alignment larger
   than the program section alignment. For example, the .PSECT
   directive specified byte alignment (the default) and the .ALIGN
   directive specified a longword alignment, or a .PSECT directive
   specified an invalid alignment.

   User Action: Correct the conflicting alignments. The .PSECT
   directive should specify the largest alignment required by the
   program section.

ALLOC

'device-name' allocated

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified device is allocated.

   User Action: None.

ALLOCCLR

blocks incorrectly marked allocated LBN 'n' to 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified logical
   blocks on the specified relative volume were marked allocated in
   the storage bit map but were not allocated to a file.

   User Action: None. The specified blocks were marked free in
   the storage bit map. The /CONFIRM qualifier is ignored in this
   operation.

ALLOCEXT

blocks allocated to lost extension file header LBN 'n' to 'n', RVN
'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified logical
   blocks on the specified relative volume were allocated to a lost
   extension file header. The specified blocks were marked free in
   the storage bit map. The /CONFIRM qualifier is ignored in this
   action.

   User Action: None.

ALLOCFAIL

file structure allocation failure for 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: Insufficient contiguous space is available on the
   specified volume to allocate the files necessary to initialize the
   volume as a Files-11 structured volume. This error may be caused
   by an excessive number of bad blocks.

   User Action: Retry the operation using another volume.

index file allocation failure

   Facility: INIT, INITIALIZE Command

   Explanation: The DCL command INITIALIZE failed to allocate space
   on the volume for the index file. This message usually indicates
   that too much space is requested for file headers.

   User Action: Reenter the command; specify a smaller value for the
   /HEADERS qualifier.


ALLOCMEM

error allocating virtual memory

   Facility: BACKUP, Backup Utility and ANALDISK, Analyze/Disk_
   Structure Utility

   Explanation: Either the Backup Utility or the Verify Utility
   encountered an error during an attempt to allocate dynamic virtual
   memory. The accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command. You may need to increase the page file quota
   of the account or the SYSGEN parameter VIRTUALPAGECNT.

error allocating virtual memory

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error allocating
   virtual memory. The accompanying message provides additional
   information.

   User Action: Take action based on the accompanying message.


ALLOCSET

blocks incorrectly marked free LBN 'n' to 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified logical
   blocks on the specified relative volume were marked free in
   the storage bit map but were allocated to a file.The specified
   blocks are marked allocated in the storage bit map. The /CONFIRM
   qualifier is ignored in this action.

   User Action: None.

ALN

alignment options error for area id = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The allocation XAB for a $CREATE or $EXTEND operation
   contains an invalid alignment boundary type (ALN field).

   User Action: The status value (STV) field of the FAB provides the
   area identification of the XAB in error. Verify that the call to
   the VMS RMS service is coded correctly.

ALPBFOVF

active looper buffer exceeded

   Facility: MOM, Maintenance Operation Module

   Explanation: An attempt to allocate a buffer to be used for a LOOP
   CIRCUIT command has failed. This may be because virtual memory has
   been exhausted.

   User Action: Take steps to increase the amount of virtual memory
   available for the process.

ALQ

invalid allocation quantity (negative, or 0 on $EXTEND)

   Facility: RMS, VMS Record Management Services

   Explanation: An invalid allocation quantity is specified in an
   allocation XAB or FAB for a $CREATE or $EXTEND operation.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. For file creation operations, the error indicates
   that the value specified is less than zero. For file extension
   operations, the error indicates that the value specified is less
   than or equal to zero.

ALRCURTID

a default transaction is currently defined

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt was made to start a default (current)
   transaction when one had already been started.

   User Action: Either terminate the transaction in progress
   before starting a new one, or run a transaction as a nondefault
   transaction.

ALREDEF

multiple .TRANSFER for symbol 'symbol-name' illegal psect 'psect-
name' offset 'number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An attempt is made to use a .TRANSFER directive on a
   symbol name more than once.

   User Action: Remove all but the first .TRANSFER directive for the
   symbol.

ALTIHDBAD

invalid alternate index file header, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the alternate index
   file header on the specified relative volume is corrupted.

   User Action: None. The alternate index file header is refreshed
   from the primary index file header.

AMBCMD

ambiguous command

   Facility: NCP, Network Control Program

   Explanation: A keyword in the command has not been specified
   with enough characters to distinguish it from another keyword
   acceptable in this context.

   User Action: Reenter the command and expand upon the specified
   keyword.

AMBDATTIM

ambiguous date-time

   Facility: LIB, Library Facility

   Explanation: The date-time input string did not match the
   specified input format.

   User Action: Examine the date-time input string and input format.

AMBIG

ambiguous field name or class name 'class-name'

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The field or class name entered is not unique.

   User Action: Reenter the field or class name with additional
   characters or enter the HELP FIELDS or HELP CLASSES commands to
   get a list of available fields or classes.

AMBIGNAME

variable 'name' cannot be a procedure

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You previously used an identifier as a variable; you
   are now attempting to use the same identifier as a procedure.

   User Action: Use a different name for the procedure.

AMBIGSYMUSED

ambiguous symbol 'name' used as procedure parameter

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The named symbol could be either an undefined
   procedure or a variable; its correct usage has not yet been
   determined. When an ambiguous symbol is used as a parameter in
   a call, the compiler is forced to generate nonoptimal code.

   User Action: Define the named symbol as either a procedure or a
   variable before using it as a call parameter.

AMBKEY

'keyword' is an ambiguous keyword

   Facility: LIB, Library Facility

   Explanation: Too few characters were used to truncate the keyword
   indicated to make it unique within its context. This message
   is associated with a status code returned from the VMS Run-Time
   Library.

   User Action: Reenter the keyword, specifying enough characters to
   make it unique.

AMBSYMDEF

ambiguous symbol definition

   Facility: LIB, Library Facility

   Explanation: The specified symbol name is ambiguous when compared
   with existing symbol names. This condition can occur when
   abbreviated symbols have been previously defined.

   User Action: Refer to the VMS DCL Dictionary for more information
   about abbreviated symbols.

ANI

not ANSI "D" format

   Facility: RMS, VMS Record Management Services

   Explanation: The records in a magnetic tape file do not conform to
   the ANSI standard for magnetic tape (D format).

   User Action: Modify the program that writes the magnetic tape file
   so that the file is in the correct format, or verify that the tape
   is an ANSI-labeled tape. If the tape is not in ANSI "D" format,
   use an alternative method of reading the file such as mounting the
   tape as a foreign tape or using VMS RMS block I/O.

AOP

allocation options error for area id = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: An allocation XAB for a $CREATE or $EXTEND operation
   specifies an invalid allocation option (AOP field).

   User Action: The status value (STV) field of the FAB provides the
   area identification of the XAB in error. Verify that the call to
   the VMS RMS service is coded correctly.

APPENDEDB

'input-filespec' appended to 'output-filespec' (nnn blocks)

   Facility: Shared by several facilities

   Explanation: An input file is being appended to an output file.
   The message displays the number of blocks or the number of records
   appended, based on the size of the input file. This message is
   informational.

   User Action: None.

APTREFHIGH

inconsistent active page table reference count

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

APTWRTERR

active page table swap write error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

AQBTIME

ACP queue is unstable

   Facility: MOUNT, Mount Utility

   Explanation: The system cannot start the ACP specified in the
   DCL command MOUNT request. This message indicates an error in the
   operating system software.

   User Action: Consult with the system manager to determine what
   events in the system might be preventing ACPs from starting.

ARCHIVEDSB

archiving disabled

   Facility: AUDSRV, Audit Server

   Explanation: Archiving is disabled.

   User Action: None. This is an informational message.

ARCHIVEMOVE

archiving ending on: 'filename'; archiving starting on: 'filename'

   Facility: AUDSRV, Audit Server

   Explanation: Archiving has been successfully redirected to a new
   archive file.

   User Action: None. This is an informational message.

ARCHIVENEW

archiving starting on: 'filename'

   Facility: AUDSRV, Audit Server

   Explanation: Archiving has been successfully enabled to the
   specified archive file.

   User Action: None. This is an informational message.

ARCNOTDISK

archive file open failure; archiving is directed to an invalid
device type

   Facility: AUDSRV, Audit Server

   Explanation: Archiving could not be enabled because the archive
   journal is not directed to a file-structured disk device.

   User Action: Redirect the archive journal to a file-structured
   disk device.

ARCOPENFAIL

archive file open failure (status: 'status')

   Facility: AUDSRV, Audit Server

   Explanation: The audit server could not open the system audit
   archive file. The specified status code indicates the exact cause
   of the problem.

   User Action: Correct the indicated error, and try again.

ARGMISMATCH

parameter 'numbers', 'data-type', and 'type' are unsupported

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The data type of the indicated parameter is not
   supported by the built-in procedure that is being called.

   User Action: To find the correct data types for this built-in
   procedure, refer to the VAX Text Processing Utility Manual or to
   online help.

ARGREQ

missing argument-supply all required arguments

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: When you invoked a lexical function, you did not
   specify all the required arguments.

   User Action: Supply all the required arguments.

ARGTOOLONG

argument too long

   Facility: MACRO, VAX MACRO Assembler

   Explanation: An argument is more than 1000 characters long.

   User Action: Reduce the length of the argument.

ARTRES

reserved arithmetic trap at PC location, PSL = xxxxxxxx

   Facility: SYSTEM, VMS System Services

   Explanation: An unknown arithmetic exception has occurred.

   User Action: This message should not occur. If it does occur,
   inform the system manager.

'AS' required

   Facility: EDT, EDT Editor

   Explanation: You omitted the word as from the syntax in the DEFINE
   KEY command.

   User Action: Reenter the command specifying the correct syntax.

ASCEFCFER

error associating to UETP common event flag cluster

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an
   error associated with the vector event flag cluster during
   initialization. This error is received in relation to a previously
   displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

ASCTOOLONG

ASCII string too long

   Facility: MACRO, VAX MACRO Assembler

   Explanation: Either the string in an .ASCIC directive is more than
   255 characters or the string in an .ASCID directive is more than
   65535 characters.

   User Action: Reduce the length of the string.

ASGNMNTSYN

assignment syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A direct assignment statement contains a syntax
   error.

   User Action: Refer to the VAX MACRO and Instruction Set Reference
   Manual for information on syntax errors and correct the syntax
   error.

ASGNQUE

could not assign logical queue 'queue-name' to execution queue
'queue-name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error occurred during a $SNDJBC system service
   call attempting to assign the queue to another executor queue.
   This error changes the first queue into a logical queue.

   User Action: The accompanying message gives information about why
   the operation failed. Correct the problem and retry the upgrade,
   or after the upgrade has completed, assign the logical queue to
   the execution queue using the DCL command ASSIGN.

ASSIGN

error assigning channel to 'device-name'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to assign a channel to the volume to be verified. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.

error assigning channel to 'device-name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: The utility encountered an error while attempting to
   assign a channel to the device.

   User Action: Examine the associated message for a clue to the
   problem, correct the trouble, and reinvoke the utility.


ASSIGNFAIL

could not assign 'device' as system disk

   Facility: BACKUP, Backup Utility

   Explanation: Standalone BACKUP could not assign a channel to the
   disk from which it was booted.

   User Action: Determine why the channel assign failed. If possible,
   correct the problem and retry the BACKUP operation. Otherwise,
   submit a Software Performance Report including full configuration
   details and a log of the output.

ASTFLT

AST fault, SP = 'xxxxxxxx' param = 'xxxxxxxx', PC = location, PSL =
'xxxxxxxx', target PC = 'location', PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: The system attempted to deliver an asynchronous
   system trap (AST) to an image, but the user stack pointer either
   is invalid or did not have sufficient space for the AST call
   frame. This message indicates an exception condition and is
   usually followed by a display of the condition arguments, the
   registers, and the stack at the time of the exception.

   User Action: Examine the parameters displayed in the message
   to determine the instruction that caused the error. Locate the
   programming error that modified the stack.

ASTRPDFER

error disabling CTRL-C and CTRL-Y AST reception

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition led led to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

ASYNCACTIVE

journal file prohibited with asynchronous handlers declared

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Creating a journal file is prohibited. Asynchronous
   action routine handlers have been declared.

   User Action: You must choose between journaling and action
   routines.

ASYNCWRTER

asynchronous write memory failure

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ATLINE

at line 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message indicates the line number of the error.

   User Action: None.

ATPC

at PC = 'xxxxxxxx'

   Facility: Shared by several facilities

   Explanation: This message generally accompanies a message
   indicating a software failure.

   User Action: Take corrective action based on the accompanying
   messages.

ATPROCLINE

at line 'integer' of procedure 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Line number of error in the procedure.

   User Action: None.

ATR

file attributes read error

   Facility: RMS, VMS Record Management Services

   Explanation: A read error occurred on a file header.

   User Action: Depending on the operation, the status value
   (STV) field in the FAB or RAB contains a system status code
   that provides additional information about the condition. Take
   corrective action based on this status code. Check the status of
   the device and repeat the request. The header block may be bad. If
   the error occurs on many files, the disk or drive may be bad. In
   that case, notify the system manager.

ATTACHED

terminal now attached to process 'process-name'

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This message is output by the DCL command ATTACH when
   it attaches to a process.

   User Action: None.

ATTCONSTO

attempt to continue from stop

   Facility: LIB, Library Facility

   Explanation: A condition handling routine attempted to continue
   from a call to LIB$STOP; that is, the routine attempted to
   continue from an error from which continuation is impossible by
   returning a successful completion status.

   User Action: Using the traceback information or PC displayed in
   the message, locate the condition handler that incorrectly tried
   to continue execution. Condition handlers can return success only
   for continuable errors and should return success only for errors
   that they have corrected. Otherwise, they should resignal the
   error.

Attempt to CUT or APPEND to current buffer

   Facility: EDT, EDT Editor

   Explanation: While trying to perform a CUT or APPEND operation,
   you named the current text buffer as the destination text buffer.
   The default destination is the PASTE text buffer.

   User Action: Copy the text to an intermediate buffer.

Attempt to PASTE the current buffer

   Facility: EDT, EDT Editor

   Explanation: The EDT command PASTE attempted to paste text into
   the same text buffer containing the text to be pasted.

   User Action: Copy the text to an intermediate buffer.

Attempt to reenter EDT

   Facility: EDT, EDT Editor

   Explanation: While using callable EDT, you attempted to recall EDT
   without having exited.

   User Action: Exit from EDT before attempting to recall EDT.

ATTREQREF

attach request refused

   Facility: DEBUG, VMS Debugger

   Explanation: The specified process could not be attached to.
   Either it is not detached or it did not belong to the caller's
   job.

   User Action: Ensure that the specified process is detached and
   belongs to the caller's job.

attach request refused

   Facility: LIB, Library Facility

   Explanation: The specified process could not be attached to.
   Either it is not detached or it did not belong to the caller's
   job.

   User Action: Ensure that the specified process is detached and
   belongs to the caller's job.


ATW

file attributes write error

   Facility: RMS, VMS Record Management Services

   Explanation: A write error occurred during an attempt by VMS RMS
   to write a file header.

   User Action: Depending on the operation, the status value (STV)
   field in the FAB or RAB contains a status code that provides
   additional information about the condition. Take corrective action
   based on this status code. Check the status of the device and
   repeat the request. The header block may be bad. If the error
   occurs on many files, the disk or drive may be bad. Notify the
   system manager.

AUTOMEMCOPY

'device-name' automatically added to the shadow set with a copy
operation

   Facility: MOUNT, Mount Utility

   Explanation: The /INCLUDE Mount qualifier was specified allowing
   members that were previously part of the shadow set to be
   automatically added to the set. The indicated device was
   successfully added to the shadow set. A copy operation was
   initiated making this device a target for all blocks.

   User Action: None.

AUTOMEMERGE

'device-name' automatically added to the shadow set with a merge
operation

   Facility: MOUNT, Mount Utility

   Explanation: The /INCLUDE Mount qualifier was specified allowing
   members that were previously part of the shadow set to be
   automatically added to the set. The indicated device was
   successfully added to the shadow set with merge semantics. The
   device is identical to the other members of the set except for
   possible incomplete writes for which the shadowing software will
   check.

   User Action: None.

AUTOMEMSUCC

'device-name' automatically added to the shadow set

   Facility: MOUNT, Mount Utility

   Explanation: The /INCLUDE Mount qualifier was specified allowing
   members that were previously part of the shadow set to be
   automatically added to the set. The indicated device was
   successfully added to the shadow set as a consistent member.

   User Action: None.

AUTOSYNC

auto-answer file is not synchronized to the current question

   Facility: VMSINSTAL, Install Procedures

   Explanation: You have specified the auto-answer option, and
   VMSINSTAL is using the answers from an existing answer file. The
   question being asked by the installation procedure does not match
   the next question and answer in the answer file.

   User Action: The installation procedure has changed. Delete the
   existing answer file and begin the installation again.

BACKLINK

incorrect directory back link 'filespec'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the back link of the
   specified file did not contain the file identification of the
   directory file in which the file is cataloged. This condition is
   normal if the file is cataloged in more than one directory.

   User Action: Set the back link pointer to point to the directory
   file. If the file is cataloged in more than one directory, you may
   want to use the /CONFIRM qualifier to direct the Verify Utility
   not to repair the back link.

Backup past top of buffer

   Facility: EDT, EDT Editor

   Explanation: You attempted to move the cursor to a position
   preceding the first line (top) of the buffer.

   User Action: Press any key to move the cursor below the top of the
   buffer.

BACKUPERR

an error has occurred in recreating the save set

   Facility: VMSINSTAL, Install Procedures

   Explanation: A BACKUP error occurred while re-creating the
   save sets in the processing of the GET option. The operation is
   aborted.

   User Action: Make sure the specified output device holds media
   that is not write protected.

BADACC

unable to CREATE/UPDATE account named "name".

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product being installed has tried to either
   create an account that already exists or modify a nonexistent
   account.

   User Action: If you can determine and resolve the problem,
   reinstall the product. Otherwise, contact your DIGITAL field
   service representative.

BADACP

invalid syntax on /PROCESSOR qualifier

   Facility: MOUNT, Mount Utility

   Explanation: The keyword or file specification value specified for
   the /PROCESSOR qualifier is not specified correctly.

   User Action: Reenter the command; refer to the VMS DCL Dictionary
   for the correct syntax.

BADACTRL

remote access control info invalid

   Facility: SMI, System Management Intergator/Server

   Explanation: The SYSMAN user cannot be validated on the indicated
   node due to one or more of the following reasons:

   o  The password is invalid.

   o  The user name (current or as overidden with a /USERNAME
      qualifer) cannot be found in the remote system UAF.

   o  The remote system UAF cannot be accessed.

   o  The remote UAF record does not have either SETPRV or OPER
      privileges authorized.

   o  The account is disabled.

   User Action: Determine why the account is invalid on the remote
   system by trying to log in directly with a DCL SET HOST command.

BADALORQSZ

bad memory allocation request size

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADARGS

unrecognized argument to procedure

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU error occurred.

   User Action: Submit a Software Performance Report (SPR).

BADASSIGN

target of the assignment cannot be a function/keyword

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The left-hand side of an assignment statement must be
   a variable. It cannot be a procedure name or a keyword.

   User Action: Use a different variable name to the left of the
   operator : = in this assignment statement.

BADATTRIB

bad attribute control list

   Facility: SYSTEM, VMS System Services

   Explanation: An invalid code or size is specified in the read or
   write attribute list for a file system ACP QIO function.

   User Action: Check for a programming error. Begin debugging
   procedures to verify the source of the problem and to correct
   the problem. Note that when using ANSI magnetic tapes, the block
   size must be 4 bytes larger than the largest record in a variable
   record length file, and the largest record that can be written is
   2048 bytes.

BADBITMAP

BITMAP.SYS too small or not contiguous, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the storage bit map
   file, [000000]BITMAP.SYS;1, on the specified relative volume is
   not large enough to accommodate the volume size and volume cluster
   factor, or that it is not contiguous. This error can result from
   an erroneous volume size in the storage control block or from an
   erroneous volume cluster factor in the home block.

   User Action: If the volume can no longer be mounted by the
   operating system, it is corrupted and must be reconstructed from
   back-up media. If the volume can be mounted, the damage can be
   repaired by copying the volume to fresh media.

BADBLK

invalid option block

   Facility: CONVERT, Convert Utility

   Explanation: You have made an error in constructing the option
   block used in the CONV$PASS_OPTIONS routine.

   User Action: Refer to the VMS System Services Reference Manual for
   instructions on building an option block.

BADBLKSIZE

'save-set-spec' has inconsistent block size

   Facility: BACKUP, Backup Utility

   Explanation: The volume mounted as a continuation volume of a
   multivolume save set is not recorded with the same block size as
   previous volumes of the save set. This volume is probably not part
   of the same save set.

   User Action: Locate and mount the correct continuation volume.

BADBLOADR

bad block address

   Facility: LIB, Library Facility

   Explanation: The library routine LIB$FREE_VM is called with an
   invalid virtual storage address.

   User Action: Begin debugging procedures to verify the problem and
   to correct the problem.

BADBLOCK

bad blocks on 'device-name' do not match input

   Facility: BACKUP, Backup Utility

   Explanation: In a COPY or RESTORE operation with the /PHYSICAL
   qualifier, a bad block is present on the output volume in a
   location where the input volume had a good block. The backup
   operation will not result in a valid Files-11 volume.

   User Action: Reevaluate the operation; another mode of operation,
   such as the /IMAGE qualifier, may be appropriate. Or retry the
   operation using either the original input volume or an error-free
   output volume.

BADBLOCKS

invalid syntax in bad block list

   Facility: INIT, INITIALIZE Command

   Explanation: The command syntax for the /BAD_BLOCKS qualifier is
   invalid.

   User Action: Reenter the command; use the DCL command HELP or
   refer to the VMS DCL Dictionary for the correct syntax. If the
   list of blocks is long, place the command in a command procedure
   file.

BADBLOSIZ

bad block size

   Facility: LIB, Library Facility

   Explanation: Either the library routine LIB$GET_VM is called
   with a request for zero blocks or the requested block size is
   too large.

   User Action: If the requested block size is zero, correct the
   source program. If the specified block size is too large, use the
   DCL command SET WORKING_SET to increase the current working set
   limit for your process and retry the program.

BADBOOTCB

corrupted Boot Control Block

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADBUFADR

ACP buffer address out of range of buffer pool

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADBUFTYP

bad ACP buffer type code

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADBUFWRITE

error occurred writing buffer 'buffer name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An I/O error occurred while writing the the contents
   of the buffer to a file. This could be due to operating system
   or VMS RMS errors. This message should be accompanied by another
   message specifying the reason for the error. The creation of the
   file stopped at the point of the error.

   User Action: Correct the specified problem and reenter your
   command.

BADBUG

please report TRACE bug no. 'nnn'

   Facility: TRACE, Traceback Facility

   Explanation: This message indicates an internal programming error
   in the Traceback Facility.

   User Action: Collect as much information as possible and submit
   a Software Performance Report; include the bug number (nnn)
   displayed in the message.

BADBYTE

invalid data 'xx' at 'location'

   Facility: Shared by several facilities

   Explanation: The specified data is invalid at the given location.

   User Action: None.

BADCACHE

invalid syntax on /CACHE qualifier

   Facility: MOUNT, Mount Utility

   Explanation: The options given with the /CACHE qualifier have
   invalid syntax.

   User Action: Verify the command and reenter the correct syntax.

BADCASE

unrecognized CASE constant

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Case constants can only be integers, keywords, or
   1-character strings.

   User Action: Check your case labels or your FROM . . . TO limits to
   ensure that the case constants follow the stated rules.

BADCASELIMIT

CASE constant outside of CASE limits

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A case constant used as a case label (inside [ . . .
   ]) does not fall within the range specified by the FROM . . . TO
   limits of your case statement.

   User Action: Modify your CASE limits or correct the case labels
   and recompile your program.

BADCASERANGE

invalid CASE range

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Either the case range or at least one case selector
   other than INRANGE or OUTRANGE must be specified.

   User Action: Specify a case range or specify at least one case
   selector other than INRANGE or OUTRANGE.

BADCCC

bad compilation completion code ('decimal-number') in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An illegal compilation completion code is found in
   the specified module.

   User Action: Recompile the module and relink.

illegal compilation code 'code' in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an internal error in the
   operating system, submit a Software Performance Report (SPR).


BADCHAR

unrecognized character in input

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A control character or some other character that is
   not recognized by the parser exists in the program you are trying
   to compile.

   User Action: Remove the unrecognized character and recompile your
   program.

BADCHKSUM

bad file header checksum

   Facility: SYSTEM, VMS System Services

   Explanation: The checksum in the file header is invalid or the
   file header may be corrupt.

   User Action: Repair the volume with the Verify Utility. Recover
   the file from the backup medium.

shared memory data structures corrupted-reinitialization necessary

   Facility: SYSGEN, System Generation Utility

   Explanation: A CRC check of the constant fields in the shared
   memory datapage has detected an error.

   User Action: Reboot all processors using the shared memory.


BADCONDEV

please specify an existing console device.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The device you specified is not a console device.

   User Action: Specify a valid console device.

BADCOPIES

'nnn' is an invalid number of copies

   Facility: Shared by several facilities

   Explanation: The number of copies is not within a valid range.

   User Action: Reenter the command; specify a different number of
   copies.

BADCSP

scope setting not module or routine

   Facility: PATCH, Patch Utility

   Explanation: The symbol specified as the new scope value is not a
   module name or routine name.

   User Action: Reenter the command using the corrected scope value.

BADCTLMSK

bad control character enable/disable mask

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You specified a control character sequence other than
   CTRL/T or CTRL/Y to enable or to disable a mask.

   User Action: Specify CTRL/T or CTRL/Y to enable or to disable the
   mask.

BADDALRQSZ

bad memory deallocation request size or address

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADDATA

error in block 'nn' of 'filespec' detected during save

   Facility: BACKUP, Backup Utility

   Explanation: A read error for the specified block of the specified
   file occurred when the save set is created. Data in this block may
   be corrupted.

   User Action: Examine the file for corruption and reconstruct
   as necessary. If this error occurs during a disk-to-disk (copy)
   operation, it indicates a software error in the Backup Utility. In
   this case, submit a Software Performance Report (SPR).

BADDATCHK

invalid keyword on /DATACHECK qualifier

   Facility: MOUNT, Mount Utility and INIT, INITIALIZE Command

   Explanation: The keyword specified for the /DATACHECK qualifier is
   neither READ nor WRITE.

   User Action: Reenter the command; specify either READ or WRITE.

BADDATDAT

data echoed invalid

   Facility: DTS, DECnet Test Program Protocol

   Explanation: This message indicates a test error.

   User Action: Retry the test.

BADDATLEN

not enough data sent/received

   Facility: DTS, DECnet Test Program Protocol

   Explanation: This message indicates a test error.

   User Action: Retry the test.

BADDELETE

cannot modify constant integer, keyword or string

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are attempting to modify an integer, keyword, or
   string constant.

   User Action: Check your program for this error and remove the
   problem statement.

BADDELIM

invalid delimiter following 'command'

   Facility: Shared by several facilities

   Explanation: An invalid character was entered as part of a
   command. This message displays the rejected portion of the
   command.

   User Action: Check the command for a spelling or syntax error;
   reenter the command.

BADDENS

unknown value on /DENSITY qualifier

   Facility: MOUNT, Mount Utility and INIT, INITIALIZE Command

   Explanation: The value specified for a tape density is not 800,
   1600, or 6250. The value specified for a diskette is not single or
   double.

   User Action: Reenter the command; specify either 800, 1600, or
   6250 for the density.

BADDEV

device is unsupported for transfer

   Facility: EXCHANGE/NETWORK Command

   Explanation: You attempted to transfer the file either to or from
   a device that is not supported by the device (such as magnetic
   tape).

   User Action: Correct an error in the device specification or try
   using a different device.

BADDIR

bad directory spec-should be dev:[dir]

   Facility: SMI, System Management Intergator/Server

   Explanation: A SYSMAN SET PROFILE/DEFAULT command specified an
   invalid device or directory, or both.

   User Action: Correct the directory specification according to the
   VMS DCL Concepts Manual.

directory 'directory' has invalid format

   Facility: BACKUP, Backup Utility and ANALDISK, Analyze/Disk_
   Structure Utility

   Explanation: The specified directory file is not in the expected
   format for a directory file. The file is corrupted.

   User Action: Use the DCL command SET FILE/NODIRECTORY to delete
   the corrupted directory file. Then use the DCL command ANALYZE
   /DISK_STRUCTURE /REPAIR to place the lost files in the [SYSLOST]
   directory. You can then copy the lost files to a new directory.


BADDIRENT

invalid file identification in directory entry 'filespec'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified directory
   entry did not contain a valid file identification. Probably, the
   file has been deleted. The directory entry is removed.

   User Action: None.

BADDISDEV

please specify a disk or tape device

   Facility: VMSINSTAL, Install Procedures

   Explanation: You specified a device on which the distribution
   media is to be mounted that is neither a disk nor a tape.

   User Action: Specify a disk or tape device.

BADDISDIR

directory "directory-name" does not exist

   Facility: VMSINSTAL, Install Procedures

   Explanation: You are trying to restore the distribution kit from a
   nonexistent directory.

   User Action: Specify the correct directory when you start
   VMSINSTAL.

BADDST

no symbols in image

   Facility: TRACE, Traceback Facility

   Explanation: The image header in an executable image file does not
   contain symbols required by the Traceback Facility. The message
   indicates an operating system problem.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BADDSTMAP

failure to map symbol table, CREMAPSEC status = 'xxxxxxxx'

   Facility: TRACE, Traceback Facility

   Explanation: The system could not perform a symbolic traceback
   because the system could not map the symbol table. The hexadecimal
   status code is the return status from an internal call to the
   Create and Map Section ($CRMPSC) system service.

   User Action: Determine the reason associated with the indicated
   status code. If the reason is anything other than a lack of
   virtual address space, assume that the problem is a system
   problem. Collect as much information as possible and submit a
   Software Performance Report (SPR).

BADDSTVBN

image symbol table VBN = 'nnn'

   Facility: TRACE, Traceback Facility

   Explanation: The Traceback Facility cannot interpret the image
   header for an executable file. This message indicates an internal
   operating system error or an error in the linker.

   User Action: Collect as much information as possible and submit
   a Software Performance Report; include the virtual block number
   (VBN) number (nnn) displayed in the message.

BADECO

illegal eco level of 'nn' in 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: An illegal ECO level is specified. The legal ECO
   level range is between 1 and 128, inclusive.

   User Action: Retry using a legal ECO level.

BADEFBLK

file ('file-id') 'filename' inconsistent EFBLK and map area

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the end-of-file pointer
   recorded in the VMS RMS record attributes for the specified file
   did not lie within the space actually allocated to the file.

   User Action: None. The end of file pointer is set to point to the
   end of the allocated space.

BADENTRY

bad format for .ENTRY statement

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The .ENTRY directive did not specify an entry point
   name and a correct entry mask.

   User Action: Correct the .ENTRY directive syntax.

BADESCAPE

syntax error in escape sequence

   Facility: SYSTEM, VMS System Services

   Explanation: A terminal escape sequence is invalid. This message
   is associated with a status code returned by I/O functions.

   User Action: Check for a programming error. Correct the escape
   sequence syntax.

BADEVTYP

bad device type, 'value' in text library module, 'module-name'

   Facility: ERF, Error Log Utility

   Explanation: A value in the specified library module is out of the
   required range.

   User Action: Submit a Software Performance Report (SPR).

BADEVVAL

bad device table value, 'value' in text library module, 'module-
name'

   Facility: ERF, Error Log Utility

   Explanation: A value in the specified library module is out of the
   required range.

   User Action: Submit a Software Performance Report (SPR).

BADEXCL

directory or device not allowed in /EXCLUDE = exclude-item

   Facility: SEARCH, SEARCH Command

   Explanation: The listed exclude item contains a network node name,
   a device name, or a directory name.

   User Action: Reenter the command, specifying only a file name, a
   file type, and a version number

BADEXCLNAM

invalid filename in /EXCLUDE = exclude-item

   Facility: SEARCH, SEARCH Command

   Explanation: The listed exclude item is not a valid VMS RMS file
   specification.

   User Action: Reenter the command with a correct file
   specification.

BADEXE

failure to open image file 'filename'

   Facility: TRACE, Traceback Facility

   Explanation: The operating system rejected the format of the
   indicated executable image file. The file cannot be opened. This
   message indicates an internal operating system error.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BADEXECLO

failure to close image file 'filename'

   Facility: TRACE, Traceback Facility

   Explanation: The operating system rejected the format of the
   indicated executable image file. The file cannot be closed. This
   message indicates an internal operating system error.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BADEXERAB

failure to connect image file 'filename'

   Facility: TRACE, Traceback Facility

   Explanation: The operating system rejected the format of the
   indicated executable image file. This message indicates an
   internal operating system error.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BADEXH

the user-mode exit handler list is corrupt

   Facility: DEBUG, VMS Debugger

   Explanation: While waking the list of user-mode exit handlers, the
   debugger detected a forward link that pointed to an inaccessible
   exit control block.

   User Action: Check for a call to the SYS$DCLEXH system service
   that specifies an illegal exit control block argument. Also verify
   that exit control blocks are not getting corrupted later in the
   program.

BADEXITIF

EXITIF occurs outside of a LOOP

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An EXITIF statement must be inside the boundaries of
   LOOP . . . ENDLOOP statements.

   User Action: Remove EXITIF statements that do not follow the
   stated rule.

BADFID

ACP file number out of range for this volume

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADFIELD

'name' field invalid at 'location'

   Facility: Shared by several facilities

   Explanation: The specified data is invalid at the given location.

   User Action: Retry the operation. If the error persists, submit a
   Software Performance Report (SPR).

BADFILE

invalid startup file name

   Facility: START, System Startup Driver

   Explanation: The named startup component file name is invalid. The
   specific reason for the error is printed before this message.

   User Action: Use the STARTUP MODIFY FILE command at the SYSMAN>
   prompt to correct the file name.

BADFILEHDR

bad file header

   Facility: SYSTEM, VMS System Services

   Explanation: The file header has failed validity checks and is
   corrupted.

   User Action: Repair the volume with the Verify Utility and recover
   the file from back-up media.

BADFILENAME

bad file name syntax

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with a status code
   returned from a file system ACP QIO request. The file name string
   for a file specification contains illegal characters or is longer
   than 39 characters.

   User Action: Check for a programming error. Verify that the file
   name strings consist only of the characters A through Z and 0
   through 9, and are no longer than nine characters.

name 'filename' not suitable for 'volume-type' volume

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility is given a file name that is not
   in the correct format for the target volume type.

   User Action: Reenter the command, using a valid file name for the
   volume shown in the message.


BADFILEVER

bad file version number

   Facility: SYSTEM, VMS System Services

   Explanation: The message indicates that the file version number in
   a file specification is greater than 32767 or contains nonnumeric
   characters. Or the file system may have attempted to create a file
   with a version higher than 32767 through defaulting rules.

   User Action: Check for a programming error. Verify that existing
   file versions are less than 32767. Rename if necessary.

BADFIRSTLINE

first line = 'integer', must be between 'integer' and 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You gave a first line argument to the built-in
   procedure CREATE_WINDOW that is outside the physical screen
   limits.

   User Action: Pick a valid first line value (between 1 and
   pagelength) and reenter your command.

BAD_FIXUPVEC

the fixup vector contains inconsistent data

   Facility: IMGACT, Image Activator

   Explanation: There are inconsistencies in the structure of the
   fixup vector in the image. This usually indicates a corrupted or
   invalid image.

   User Action: Relink the image.

BADFLAG

bad enable/disable flag

   Facility: START, System Startup Driver

   Explanation: The enable/disable flag describing how the list of
   nodes associated with a startup component file should be used is
   invalid.

   User Action: Use the SYSMAN command STARTUP ENABLE/DISABLE to
   modify this entry in the startup component file.

BADFORKIPL

bad FORK exit interrupt priority level

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADFORM

'form-type' is an invalid form type

   Facility: Shared by several facilities

   Explanation: The form type specified with the /FORMS qualifier is
   not one of the forms defined as follows:

   SYS$SYSROOT:[SYSMGR]FORMSTYPE.DAT.l

   User Action: Respecify the form type with a valid form name.

invalid option for /FORMAT = 'format-option'

   Facility: SEARCH, SEARCH Command

   Explanation: The option given for the /FORMAT qualifier is not
   valid. This message is issued with an accompanying message
   providing more information about why the format option is not
   acceptable.

   User Action: Reenter the command using one of the valid format
   options.


BADFRAME

bad FP or bad saved FP at 'pointer-addr' in call stack, cannot read
frame near 'frame-addr'

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger is trying to chain down the call stack,
   following frame pointers. The FP register (if 'pointer-addr' is
   "FFFFFFFF") or the saved frame pointer at location 'pointer-addr'
   points to a frame at least part of which is not read accessible
   near the location of 'frame-addr'.

   User Action: Determine what part of your code is writing into the
   FP register or overwriting the saved frame pointer on the call
   stack (or a preceding saved frame pointer) and correct it. Since
   the debugger looks at the call stack to symbolize addresses, you
   may suppress some of these messages by typing the command SET MODE
   NOSYMBOLIC.

BADFRMT

volume is not mounted with Files-11 format

   Facility: SET, SET Facility

   Explanation: The volume is mounted with the /FOREIGN qualifier; it
   cannot be modified.

   User Action: None.

BADFUNC

invalid function type received

   Facility: DTR, DECnet Test Program Protocol

   Explanation: The DECnet-VAX test program has a protocol
   incompatibility.

   User Action: Run the test against a compatible version of DTRECV
   or an equivalent.

BADGETDIR

directory 'directory-name' does not exist.

   Facility: VMSINSTAL, Install Procedures

   Explanation: You are trying to copy the specified product save set
   to a nonexistent directory.

   User Action: Specify the correct directory when you start
   VMSINSTAL.

BADGSD

unknown type of GSD entry: 'GSD'

   Facility: SDA, System Dump Analyzer

   Explanation: SDA encountered a type of global symbol that it does
   not recognize, either in the SYS.STB file or in a file specified
   in the SDA command READ. The type of global symbol definition GSD
   is represented by a byte.

   User Action: This message can occur during either initialization
   or operation of the SDA and usually means that the file being read
   has been corrupted. Check the integrity of the symbol table file.

BADHDR

an error is discovered in the image header

   Facility: IMGACT, Image Activator

   Explanation: The image header type word contains an invalid type
   code. This usually indicates a corrupted or invalid image.

   User Action: Relink the image.

no symbol table data in image header

   Facility: TRACE, Traceback Facility

   Explanation: The image header in the executable image file does
   not contain expected symbol table data. This message indicates an
   internal operating system error.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).


BADHEADER

file ('file-id') 'filename' invalid file header

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified file
   header is corrupt.

   User Action: None. The file is rewritten with a deleted file
   header. If the specified file header is currently in use, the
   file can no longer be accessed by the operating system and must be
   reconstructed from backup media. If the file header is not in use,
   no action is necessary.

BADHIBLK

file ('file-id') 'filename' inconsistent HIBLK and map area

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the file size recorded
   in the VMS RMS record attributes did not agree with the number of
   blocks actually allocated to the file.

   User Action: None. The record attributes are corrected by changing
   the file size to reflect the correct number of blocks.

BADHOMBLK

bad home block encountered on volume

   Facility: MOUNT, Mount Utility

   Explanation: An I/O error occurred while reading a home block
   during /BIND processing. A subsequent message explains the nature
   of the error. The first occurrence of this message is a warning;
   the second is fatal.

   User Action: Repair with the Verify Utility or reinitialize the
   volume and retry the operation.

BADIDENT

unable to patch image with ident of 'nn'

   Facility: PATCH, Patch Utility

   Explanation: PATCH does not recognize this version of the image
   file.

   User Action: Relink your image file. Ensure that the file being
   patched is a native mode image file.

BADIF

IF statement contains an assignment statement

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The IF expression in an IF . . . THEN statement must
   contain logical operators only. This message is likely to occur
   if you used the expression x: = y instead of the the Boolean
   expression x = y. The IF expression in an IF . . . THEN statement
   makes a logical comparison.

   User Action: Change the operator : = to the operator =.

BADIMGHDR

bad image header

   Facility: SYSTEM, VMS System Services

   Explanation: An image to be executed with the DCL command RUN
   or within a process is not in the correct format and cannot be
   executed.

   User Action: Verify that the specified file is an executable
   image. If necessary, recompile or reassemble and relink the
   program to ensure that the image file is in the proper format.

bad image header in shareable image file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A shareable image contains a bad image header, or the
   file is not a shareable image.

   User Action: Correct and relink.


BADINDEX

invalid syntax on /INDEX qualifier

   Facility: INIT, INITIALIZE Command

   Explanation: The command syntax for the /INDEX qualifier is
   invalid.

   User Action: Reenter the command; use the DCL command HELP or
   refer to the VMS DCL Dictionary for the correct syntax.

BADINITSZ

illegal size value defaulting patch size to 'xxxxxxxx' bytes

   Facility: PATCH, Patch Utility

   Explanation: The size-expression input argument did not fall
   within the valid range. PATCH set the patch area to the address
   named in the SET PATCH_AREA command, and use the default patch
   area size to build the patch area descriptor.

   User Action: Continue to enter patches into the user-defined patch
   area. To see the current status of the patch area, enter the SHOW
   PATCH_AREA command.

BADIONAME

'name' has not been previously defined

   Facility: CDU, Command Definition Utility

   Explanation: There is an undefined name in the output list.

   User Action: Check the spelling of the name in the output list.

BADIRECTORY

bad directory file format

   Facility: SYSTEM, VMS System Services

   Explanation: The message indicates that the specified directory
   file is not valid. Either the file is not a directory or the
   directory file contains invalid data.

   User Action: Check for a programming error. Verify that the
   specified file is a directory. If necessary, repair the volume
   with the Verify Utility.

BADISD

illegal image section descriptor

   Facility: SYSTEM, VMS System Services

   Explanation: This severe error message is associated with a status
   code returned from a system service request. An illegal image
   section descriptor is encountered.

   User Action: This file may be corrupted or may not be an
   executable image. There also may be a problem associated with
   the linker; in this case, submit a Software Performance Report
   (SPR).

BADJOBID

'job-id' is a bad job identifier

   Facility: Shared by several facilities

   Explanation: The job identifier specified by the /ENTRY qualifier
   is missing or not valid.

   User Action: Respecify a valid job identifier by using the DCL
   command SHOW QUEUE.

BADJOBNAME

'job-name' is an invalid job name

   Facility: Shared by several facilities

   Explanation: The job name specified by the /NAME qualifier is
   missing or not valid.

   User Action: Respecify the job name with one of the job names
   listed in the DCL command SHOW QUEUE.

BADJOUCHAR

expected character in journal file

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Something other than a character is found in the
   journal file when a character is expected.

   User Action: If the recovered information is sufficient, resume
   editing from this point. VAXTPU has recovered as much as it can
   from your journal file.

BADJOUCOM

journaled command file is 'filename', recovering with 'filename'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different command file than is used during the original editing
   session.

   User Action: Stop the recovery session, and restart using the
   correct (the original) section and command files.

BADJOUCPOS

journaled starting character was 'character number', recovering with
'original character number'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different starting character number than was used during the
   original editing session.

   User Action: Stop the recovery session, and restart it using the
   original starting character number.

BADJOUEDIT

journaled edit mode was 'mode-setting', recovering with 'original
mode-setting'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different edit mode setting than was used during the original
   editing session.

   User Action: Stop the recovery session, and reset the terminal
   characteristics to those used in the original editing session.

BADJOUEIGHT

journaled eightbit was 'eightbit setting', recovering with 'original
eightbit setting'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different 8-bit setting than was used during the original editing
   session.

   User Action: Stop the recovery session, and reset the terminal
   characteristics to those used in the original editing session.

BADJOUFILE

operation terminated due to error in journal file access

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The journal file operation stopped because the
   journal file could not be accessed.

   User Action: Correct the problem preventing access to the journal
   file and try again.

BADJOUINIT

journaled init file was 'init-filename', recovering with 'original-
init-filename'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different initialization file than was used during the original
   editing session.

   User Action: Stop the recovery session, and restart it using the
   original initialization file.

BADJOUINPUT

journaled input file was 'input-filename', recovering with
'original-input-filename'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different input file than was used during the original editing
   session.

   User Action: Stop the recovery session, and restart it using the
   original input file.

BADJOUKEY

expected key in journal file

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Something other than a key is found in the journal
   file when a key is expected.

   User Action: If the recovered information is sufficient, resume
   editing from this point. VAXTPU has recovered as much as it can
   from your journal file.

BADJOULINE

journaled with line editing 'string', recovering with line editing
'string'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different line editing setting than is used during the original
   editing session.

   User Action: Stop the recovery session and reset the terminal
   characteristics to those used in the original editing session.

BADJOULPOS

journaled starting line was 'line-number', recovering with
'original-line-number'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different starting line number than was used during the original
   editing session.

   User Action: Stop the recovery session, and restart it using the
   original starting line number.

BADJOUPAGE

journaled page length is 'integer', recovering with page length
'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different page length than was used during the original editing
   session.

   User Action: Stop the recovery session, and reset the terminal
   characteristics to those used in the original editing session.

BADJOUSEC

journaled section is 'string', recovering with 'string'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different section file than was used during the original editing
   session.

   User Action: Stop the recovery session, and restart it using the
   correct (original) section file.

BADJOUSTR

expected string in journal file

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Something other than a string is found in the journal
   file when a string is expected.

   User Action: If the recovered information is sufficient for your
   needs, resume editing from this point. VAXTPU has recovered as
   much as it can from your journal file.

BADJOUTERM

journaled terminal type was 'string', recovering with a 'string'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   terminal different from that used in the original editing session.
   This might result in journal file inconsistencies.

   User Action: Stop the recovery session and reset the terminal
   characteristics to those used in the original editing session.

BADJOUWIDTH

journaled width is 'integer', recovering with width 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The editing session is being recovered with a
   different screen width than was used during the original editing
   session.

   User Action: Stop the recovery session and reset the terminal
   characteristics to those used in the original editing session.

BADJRNL

invalid syntax on /JOURNAL qualifier

   Facility: MOUNT, Mount Utility

   Explanation: You have entered the wrong command line syntax.

   User Action: Correct the syntax and reenter.

BADKEY

'keyword' is an invalid keyword

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An invalid keyword was specified as an argument to a
   built-in procedure.

   User Action: Correct the statement and reexecute the procedure.

'keyword' is an invalid keyword

   Facility: Shared by several facilities

   Explanation: An invalid keyword is specified. The message displays
   the rejected portion of the command.

   User Action: Check the command for a spelling or syntax error. Use
   the DCL command HELP or refer to the VMS DCL Dictionary for the
   valid keywords and reenter the command.

illegal key

   Facility: LIBRAR, LIBRARY Command

   Explanation: This severe error message is generated by the DCL
   command LIBRARY. The specified module is illegal.

   User Action: Reenter the command line specifying a legal module.



BAD_KEY

invalid key specification

   Facility: SORT, Sort/Merge Utility

   Explanation: The key field size, position, data type, or order
   is incorrect within the key definition. Positions start at 1 and
   cannot be greater than the maximum record size. Record size must
   be less than or equal to 32,767 for character data; 1, 2, 4, 8, or
   16 for binary data; and less than or equal to 31 for decimal.

   User Action: Check the command string key specifiers.

BADLABELQ

invalid keyword on /LABEL qualifier

   Facility: INIT, INITIALIZE Command

   Explanation: An invalid keyword is specified with the /LABEL
   qualifier. The only keyword compatible with the /LABEL qualifier
   is shown as follows:

   /LABEL=VOLUME_ACCESSIBILITY:"single-character"

   User Action: Specify the following keyword and retry:

   =VOLUME_ACCESSIBILITY:"single-character"

BADLCKWSLE

bad locked working set list entry, not a page table

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADLEXARG

illegal lexical function argument

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The argument to a macro string operator is invalid.
   String arguments can be macro arguments or strings delimited by
   angle brackets or the circumflex delimiters. Symbol arguments can
   be absolute symbols or decimal integers.

   User Action: Correct the argument syntax.

BADLEXFORM

illegal format for lexical function

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The macro string operator contained a syntax error.

   User Action: Correct the macro string operator syntax.

BADLOGIC

internal logic error detected [at PC location]

   Facility: Shared by several facilities

   Explanation: This message indicates an internal software error.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR). (See BADLOGICPC message.)

internal logic error detected, please report error 'errorcode'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an unexpected
   condition and terminated.

   User Action: Please submit a Software Performance Report (SPR),
   describing the error number and the commands that resulted in
   the message. If the error is only reproducible using a particular
   piece of media, please send a copy of the media with the SPR (use
   the BACKUP/PHYSICAL command to make the copy).


BADLOGICPC

internal logic error detected at PC = location

   Facility: Shared by several facilities

   Explanation: An internal error has occurred; location indicates
   the value of the PC at the time the error is detected. The
   assembler does not produce an object module or listing file.

   User Action: Retry the operation. If the error is reproducible,
   notify your system manager and submit a Software Performance
   Report; include the address displayed with the error message and
   the source program.

BADLONG

invalid data 'xxxxxxxx' at 'location'

   Facility: Shared by several facilities

   Explanation: The specified data is invalid at the given location.

   User Action: None.

BAD_LRL

record length n greater than specified longest record length

   Facility: SORT, Sort/Merge Utility

   Explanation: In reading the input file, SORT encountered a record
   longer than the specified LRL (longest record length specified in
   bytes). The record will be truncated to the LRL and sorted.

   User Action: Reexecute the SORT command with a longer LRL.

BADMARGINS

margins specified incorrectly

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The margin arguments passed to FILL or SET
   (MARGINS, . . . ) are invalid. The left margin must be less than
   the right margin and greater than 0. The right margin must be less
   than or equal to the maximum record size for the buffer.

   User Action: Correct the margin specifications and reenter your
   command.

BADMATCH

invalid option for /MATCH = match-option

   Facility: SEARCH, SEARCH Command

   Explanation: The option specified for the /MATCH qualifier is
   not valid. This message is issued with an accompanying message
   providing more information about why the match option is not
   acceptable.

   User Action: Reenter the command using one of the valid match
   options.

BADMCKCOD

bad machine check code

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and that includes a
   BACKUP save set containing the system dump file and the error log
   file active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADMODE

invalid mode for startup file

   Facility: START, System Startup Driver

   Explanation: A startup component file in the startup component
   database has an execution mode that is not DIRECT, BATCH, CALLED,
   SPAWN, or ANY.

   User Action: To correct the component execution mode, use the
   STARTUP MODIFY FILE command at the SYSMAN> prompt.

BADMODNAM

bad module name key 'key-name'

   Facility: ERF, Error Log Utility

   Explanation: The specified library module was not found.

   User Action: Submit a Software Performance Report (SPR).

BADMOPFCT

bad MOP function received from target

   Facility: MOM, Maintenance Operation Module

   Explanation: A MOP message is rejected because the MOP Code field
   contains an invalid value.

   User Action: Correct the MOP Code field in the device transmitting
   the MOP message.

BADMOPPGM

bad MOP program type received from target

   Facility: MOM, Maintenance Operation Module

   Explanation: A MOP message is rejected because the MOP Program
   Type field contains an invalid value.

   User Action: Correct the MOP Program Type field in the device
   transmitting the MOP message.

BADMOPPROC

bad MOP processor type received from target

   Facility: MOM, Maintenance Operation Module

   Explanation: A MOP message is rejected because the MOP Processor
   field contains an invalid value.

   User Action: Correct the MOP Processor field in the device
   transmitting the MOP message.

BADMOPSID

bad MOP software ID received from target

   Facility: MOM, Maintenance Operation Module

   Explanation: A MOP message is rejected because the MOP Software ID
   field contains an invalid value.

   User Action: Correct the MOP Software ID field in the device
   transmitting the MOP message.

BADMOPVER

incompatible MOP version

   Facility: MOM, Maintenance Operation Module

   Explanation: A MOP message is rejected because the MOP Format
   Version field contains an invalid value.

   User Action: Correct the MOP Format VBersion field in the device
   transmitting the MOP message.

BADMSG

invalid management message

   Facility: NCP, Network Control Program

   Explanation: The form of the data from NML could not be parsed
   correctly. The information accompanying this message explains the
   reason.

   User Action: Use the SET EXECUTOR NODE command to reestablish a
   link for the executor because the reception of messages might be
   out of synchronization with NML.

unknown sub-message type

   Facility: REM, Set Host Facility

   Explanation: This message indicates an internal software error.

   User Action: Submit a Software Performance Report (SPR).


BADNODFORM

improper node::remoteuser format

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You specified the format for the remote node and user
   incorrectly. The correct format consists of a node name, a pair
   of colons (::),  and the user name of the remote user. A node name
   may consist of one to six alphanumeric characters and must contain
   at least one alphabetic character. If you use a wildcard character
   for either the node or user, you must still include the pair of
   colons.

   User Action: Reenter your command with the correct format.

BADOFFSET

image header offset is invalid

   Facility: IMGACT, Image Activator

   Explanation: One of the offsets within the image header to
   specific parts of the image header is invalid. This usually
   indicates a corrupted or invalid image.

   User Action: Relink the image.

BADOPCODE

opcode 'opcode-name' is unknown

   Facility: DEBUG, VMS Debugger

   Explanation: The opcode 'opcode-name' specified in the deposit
   command is unknown to the debugger. If the opcode is a valid
   VAX MACRO opcode, then it will have a synonymous opcode. These
   opcodes, such as MOVAF and MOVAL, generate the same instruction.
   The debugger recognizes only one of them.

   User Action: Specify a valid opcode or specify an opcode synonym
   that the debugger accepts.

opcode 'xx' is unrecognized

   Facility: PATCH, Patch Utility

   Explanation: You specified an instruction that PATCH did not
   recognize. Note: PATCH does not accept abbreviations for
   instructions. For example, ADDL cannot be substituted for ADDL2.

   User Action: Reenter the corrected command.


BADOPEN

unable to locate BOOT file

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: SYSBOOT.EXE is not found or is not accessible in the
   specified satellite system root directory.

   User Action: Check the satellite system root for the file and
   verify that it has the proper protection.

BAD_ORDER

merge input is out of order

   Facility: SORT, Sort/Merge Utility

   Explanation: A MERGE input file is not in order on the specified
   key. In this message, 'number' refers to the number of the input
   file in the list of input files.

   User Action: Sort the specified file and resubmit the file to
   MERGE.

BADOUTBAND

invalid out of band AST specification

   Facility: REM, Set Host Facility

   Explanation: A protocol error has occurred.

   User Action: Submit a Software Performance Report (SPR).

BADOVR

unknown keyword on /OVERRIDE qualifier

   Facility: MOUNT, Mount Utility and INIT, INITIALIZE Command

   Explanation: The command syntax for the /OVERRIDE qualifier is
   invalid.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary for the legal keywords, and reenter the command.

BADPAD

bad format for PAD keyword on /RECORD_FORMAT qualifier

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility found an invalid value in the
   PAD option of the /RECORD_FORMAT qualifier.

   User Action: Reenter the command using a correct format for
   /RECORD_FORMAT=PAD, such as /RECORD_FORMAT=PAD=%XFF.

BADPAGFILA

bad page file address allocated

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADPAGFILD

bad page file address deallocated

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADPAGTYPE

bad page type

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADPARAM

unable to find load assist parameter

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: Parameters defined in the MOP downline load database
   or the satellite's SYSGEN parameter file, VAXVMSSYS.PAR, were not
   set properly.

   User Action: Check the MOP database using the NCP command SHOW
   NODE 'node-name' CHAR and check the SYSGEN parameters for the
   satellite with the SYSGEN command SHOW/CLUSTER.

bad parameter

   Facility: LBR, Librarian Subroutine Package

   Explanation: An illegal value is passed to an LBR routine.

   User Action: Check the values being passed and correct the illegal
   value.

bad parameter value

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).

bad parameter value

   Facility: SYSTEM, VMS System Services

   Explanation: A value specified for a system function is not valid.
   Several conditions can cause this error:

   1. If this message occurs as a result of a call to a file system
      ACP function, it indicates that parameter list options are not
      valid.

   2. If this message occurs as a result of a call to the Formatted
      ASCII Output ($FAO) system service, it indicates that a control
      string contained an unknown directive.

   3. If this message occurs as a result of a call to a network
      ACP control function, it indicates that one of the function
      parameters is out of range or has an invalid format.

   4. If this message is associated with a status code returned by
      a request to a DR32 interface, an attempt is made to set the
      data rate higher than the rate allowed by the SYSGEN parameter
      /XFMAXRATE.

   5. If this message is associated with a status code returned
      by a request to a DR11-W interface, an odd transfer count is
      specified by the P2 argument.

   6. If this message is associated with a status code returned by
      a request to a DMP11 interface, the parameter code that is
      rejected is given in the second longword of the IOSB. The
      parameter could have been rejected for one of the following
      reasons: (a) the parameter is not recognized, (b) the parameter
      value is not legal, or (c) the state is inconsistent with the
      parameter value requested.

   7. If this message is associated with turning on fallback,
      fallback may not be loaded or the virtual terminal may be
      disconnected. Reconnect the virtual terminal and enter the
      request again. If the FB driver is not loaded, ask your system
      manager to enable fallback.

   User Action: Using the debugger if necessary, determine the system
   service call that returned the error. Verify that the call to
   the service is coded correctly. Refer to the VMS System Services
   Reference Manual for coding specifications.

improperly coded NML parameter

   Facility: EVL, Event Logger

   Explanation: The event receiver detected an improperly coded NML
   parameter.

   User Action: None. The parameter is not displayed.

insufficient shared memory to create specified data structures

   Facility: SYSGEN, System Generation Utility

   Explanation: The sum of all the data structures specified is more
   than the available amount of shared memory.

   User Action: Recalculate memory usage and reenter the command.






BADPARSETBL

internal error-invalid parsing table detected

   Facility: MOM, Maintenance Operation Module

   Explanation: An internal table is invalid. This is a program logic
   error and should be reported.

   User Action: Submit a Software Performance Report (SPR).

BADPAT

invalid data pattern received

   Facility: DTR, DECnet Test Program Protocol

   Explanation: This message indicates a test error.

   User Action: Retry the test and submit a Software Performance
   Report (SPR).

BADPKT

internal error-Remote packet format bad

   Facility: SMI, System Management Intergator/Server

   Explanation: The packet received by SMISERVER is invalid for one
   of the following reasons:

   o  The packet format is too short.

   o  The object or function code is out of range.

   o  The originator PID is zero.

   User Action: Submit a Software Performance Report showing all
   SYSMAN commands leading to this error.

BADPNAME

illegal parameter name, must be P1 through P8

   Facility: CDU, Command Definition Utility

   Explanation: The specified parameter name is not P1 through P8.

   User Action: Edit the CLD file to include a legal parameter name.

BADPRO

invalid syntax on /PROTECTION qualifier

   Facility: MOUNT, Mount Utility and INIT, INITIALIZE Command

   Explanation: The command syntax for the /PROTECTION qualifier is
   incorrect.

   User Action: Type the DCL command HELP SPECIFY PROTECTION or refer
   to the VMS DCL Dictionary for the correct syntax, and reenter the
   command.

BADPROC

no such process

   Facility: SDA, System Dump Analyzer

   Explanation: The process name specified in the DCL commands SHOW
   PROCESS or SET PROCESS refers to a process that does not exist.

   User Action: Specify the correct process.

BADPROCNAME

variable used as a procedure

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A variable name is being used in a PROCEDURE
   statement or is being used as the name of a procedure being
   called.

   User Action: Change the name of the procedure.

BADPROG

procedure definitions must precede statements in a program

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: In a VAXTPU program, all procedure definitions must
   precede the executable program statements.

   User Action: Reorder your program so that all procedure
   definitions appear before the executable statements.

BADPROGDELETE

cannot delete current program

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The currently active program is attempting to delete
   itself.

   User Action: Do not use DELETE 'current_program' from within the
   current program.

BADPROMPTLEN

Prompt area length = 'integer', must be between 'integer' and
'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The length argument you specified to the SET PROMPT_
   AREA built-in goes beyond the screen's physical limits.

   User Action: Use valid arguments and reenter the command.

BADPRTY

'priority' is an invalid priority

   Facility: Shared by several facilities

   Explanation: Priority must be within the range of 0 to 31.

   User Action: Respecify the priority within the acceptable range.

BADPSC

transfer address in unknown psect ('decimal-number') in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module specified a nonexistent psect for
   the transfer address.

   User Action: Correct the source and relink.

BADQFILE

invalid disk quota file format

   Facility: SYSTEM, VMS System Services

   Explanation: The quota file has an invalid format.

   User Action: Delete and re-create the quota file [0,0]QUOTA.SYS
   with the Diskquota Utility.

BADQHDR

interlocked queue header corrupted

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADQNAME

'queue-name' is an invalid queue name

   Facility: Shared by several facilities

   Explanation: The queue name is not an initialized device or batch
   queue.

   User Action: Respecify with one of the queues listed in the DCL
   command SHOW QUEUE.

BADQUAL

qualifier /'qualifier' is inconsistent with the operation type

   Facility: BACKUP, Backup Utility

   Explanation: The specified qualifier cannot be used with the type
   of BACKUP operation indicated by the BACKUP command.

   User Action: Reenter the BACKUP command without the specified
   qualifier or select a different operation type. For more
   information on how qualifiers affect the BACKUP command, see the
   VMS Backup Utility Manual.

BADQUEUEHDR

interlocked queue corrupted

   Facility: SYSTEM, VMS System Services

   Explanation: An interlocked queue is corrupted. If this message
   is associated with a status code returned by a request to a DR32
   interface, an INPTQ or TERMQ interlock timeout has occurred.

   User Action: Determine why the queue became corrupted and correct
   the problem.

BADRANGE

bad block address not on volume

   Facility: INIT, INITIALIZE Command

   Explanation: A block number specified for the /BADBLOCKS qualifier
   is a nonexistent block.

   User Action: Verify the command line with the current bad block
   data and reenter the command. If the error persists, run the Bad
   Block Locator Utility to obtain the correct data.

inconsistent START and END specifications

   Facility: DUMP, File Dump Utility

   Explanation: In the /BLOCKS or /RECORDS qualifier, the START value
   is greater than the END value.

   User Action: Reenter the command specifying a valid range.


BADRCT

Replacement and Caching Table unrecoverable I/O error

   Facility: SYSTEM, VMS System Services

   Explanation: The Replacement and Caching Table is unreadable or
   invalid. This message applies only to devices governed by the Mass
   Storage Control Protocol (MSCP). This message could indicate that
   the read mechanism on the disk is defective or that the data on
   the disk is corrupted.

   User Action: Try to copy user data from this volume to a new
   volume. If this fails, contact DIGITAL field service.

BADREAD

read next or read prev with current record of 0, dscb: 'address'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message indicates an internal VAXTPU failure.

   User Action: Submit a Software Performance Report (SPR).

BADREFCNT

ref count: 'ccc', zap count: 'zzz', address: 'xxxxxxxx'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Internal VAXTPU failure.

   User Action: Please submit a Software Performance Report (SPR).

BADREPLY

unknown type of operator reply, reply is 'reply'

   Facility: BACKUP, Backup Utility

   Explanation: The operator's reply indicated in the message is an
   unknown type and cannot be processed.

   User Action: See the operator or your system manager for an
   indication of the problem.

unknown type of operator reply, reply = 'text'

   Facility: MOUNT, Mount Utility

   Explanation: An error has occurred in OPCOM.

   User Action: Retry the MOUNT request.


BADREQUEST

request 'name' is not understood

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The type of information you requested from GET_INFO
   is not understood or supported for that particular data type.

   User Action: Reenter with a request string that is valid for the
   data type of the first parameter.

BADRETURN

RETURN occurs outside of a procedure

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A RETURN statement must be inside the boundaries of a
   PROCEDURE . . . ENDPROCEDURE block.

   User Action: Either remove the indicated RETURN statement, or
   place it within procedural boundaries.

BADRSEIPL

bad IPL at entrance to report schedule event

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADRVNWCB

inconsistent RVN in window map pointer

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADSBMBLK

ACP tried to reference off end of bitmap

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADSCOPE

invalid path name 'path-name', SCOPE not changed

   Facility: DEBUG, VMS Debugger

   Explanation: The scope 'path-name' specified in the SET SCOPE
   command contained a path name that does not exist.

   User Action: Specify a valid scope.

BADSECTION

bad section file

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The section file is invalid.

   User Action: Use a valid section file.

BADSEQNUM

invalid data sequence received

   Facility: DTR, DECnet Test Program Protocol

   Explanation: This message indicates a test error.

   User Action: Retry the test.

BADSETAFF

attempt to set process affinity to primary CPU failed

   Facility: SYSGEN, System Generation Utility

   Explanation: SYSGEN cannot set process affinity to the primary
   CPU.

   User Action: Submit a Software Performance Report (SPR).

BADSETCNT

incorrect number of devices in output specification

   Facility: BACKUP, Backup Utility

   Explanation: The output specification for a copy, restore, or
   compare operation with the /IMAGE qualifier must be a list
   containing the same number of devices as the number of volumes
   in the input volume set.

   User Action: If the input is a save set, use the DCL command
   BACKUP/LIST to determine how the save set was created; reenter
   the command.

BADSIGARG

bad sigarg pointer at 'pointer-addr' or bad sigarg vector, cannot
read sigarg vector near 'sigarg-addr'

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger is trying to chain down the call stack
   (following frame pointers) and has encountered an exception
   handler. The signal argument pointer at location 'pointer-addr'
   points to a signal argument vector at least part of which is not
   READ accessible near location 'sigarg-addr'.

   User Action: Determine what part of your code is overwriting the
   stored signal argument pointer on the call stack, or part of the
   signal argument vector itself, and correct it. Since the debugger
   looks at the call stack to symbolize addresses, you may suppress
   some of these messages by typing the command SET MODE NOSYMBOLIC.

BADSORT

error trying to sort input file

   Facility: CONVERT, Convert Utility

   Explanation: This message will be accompanied by a SORT error
   message that explains the error.

   User Action: Correct the error described in the SORT error message
   and try again.

BADSPC

no user matched specification

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You entered a user specification that does not match
   any existing user account.

   User Action: Enter a user specification that matches at least one
   existing user account.

BADSPEC

file specification cannot be parsed using default specification.

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL cannot locate the file because of an
   invalid file specification.

   User Action: Resolve the problem, and reinstall the product.
   Otherwise, contact your DIGITAL field service representative.

BADSPLINDEX

invalid spin lock index

   Facility: SDA, System Dump Analyzer

   Explanation: You specified an invalid spin lock index to the SDA
   command SHOW SPIN LOCKS. The index specified does not correspond
   to any spin lock in the system.

   User Action: Reenter the command. Specify a valid spin lock index
   or a spin lock name.

BADSPLNAME

no spin lock could be found by that name

   Facility: SDA, System Dump Analyzer

   Explanation: You specified an incorrect name to the SDA command
   SHOW SPIN LOCKS.

   User Action: Reenter the command. Specify a valid spin lock name
   or a spin lock index.

BAD_SRL

record length 'number' is too short to contain keys

   Facility: SORT, Sort/Merge Utility

   Explanation: A record passed to SORT/MERGE is too short to contain
   all the keys. The record is discarded, and processing continues.

   User Action: Check your input records and key specification.

BADSTA

bad stack

   Facility: LIB, Library Facility

   Explanation: The user stack has an invalid format or cannot be
   accessed.

   User Action: Recompile your program with the /CHECK=BOUNDS
   qualifier to determine whether an array reference is out of
   bounds. If this does not correct the problem, use the debugger
   to determine where your program modifies the stack.

BADSTACK

bad stack encountered during exception dispatch

   Facility: SYSTEM, VMS System Services

   Explanation: An exception condition occurred during the execution
   of an image; the exception dispatcher noted an inconsistency in
   the call stack while searching for condition handlers.

   User Action: Check for a programming error. Locate the error that
   caused the stack pointers to be overwritten or modified.

stack corrupted-no further data available

   Facility: DEBUG, VMS Debugger

   Explanation: While displaying part of the call stack, the debugger
   determined that the stack is corrupted and cannot continue
   executing the command.

   User Action: See the accompanying message for more information.

stack has been overwritten

   Facility: TRACE, Traceback Facility

   Explanation: The Traceback Facility cannot display the user
   stack because it has determined that the frame pointers are
   inconsistent.

   User Action: Check for the programming error that caused the stack
   to be overwritten. Correct the source program.



BADSTART

starting block beyond maximum legal block 'number'

   Facility: DUMP, File Dump Utility

   Explanation: You have attempted to dump beyond the maximum block
   size of the device.

   User Action: Use the $GETDVI System Service to verify that the
   starting block is within the legal boundary of the device.

BADSTARTPC

cannot access start PC = 'address-value'

   Facility: DEBUG, VMS Debugger

   Explanation: Location 'address-value' is not an accessible address
   and therefore cannot be executed. This is often caused when a GO
   command with no address specification is entered after the program
   has terminated. The debugger tries to execute an instruction at
   location 0, which is not accessible.

   User Action: Specify a different address specification in the GO
   command or, if the program has terminated, you can exit from the
   debugger and initiate the program with the DCL command RUN.

BADSTATUS

bad status returned from 'routine-name'

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger got an unexpected error status from the
   system service or RTL routine 'routine-name'.

   User Action: Examine the error message to determine if the
   problem is related to a lack of quota or otherwise related to
   your program. If so, then take corrective action. If, after this
   evaluation, you believe that the problem lies in the debugger,
   then submit a Software Performance Report (SPR).

return status 'xxxxxxxx' different than last signal 'xxxxxxxx'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message indicates an internal VAXTPU error.

   User Action: Submit a Software Performance Report (SPR).


BADSTRCNT

invalid string count found in journal file

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An invalid string is found in the journal file.

   User Action: If the recovered information is sufficient, resume
   editing from this point. VAXTPU has recovered as much as it can
   from your journal file.

BADSTRLVL

structure level in command tables not recognized

   Facility: CDU, Command Definition Utility

   Explanation: Either the input tables file is corrupt or the CLI
   tables are not valid.

   User Action: If the input tables file is corrupt, it cannot be
   used again. To determine whether the CLI tables are valid, check
   for incompatible versions of the CLI and SET COMMAND.

unrecognized structure level for command tables

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Obsolete command tables (DCLTABLES) were used.

   User Action: Use the correct version of tables in the
   SYS$LIBRARY:DCLTABLES file.


BADSTRUCT

invalid value on /STRUCTURE qualifier

   Facility: INIT, INITIALIZE Command

   Explanation: The only legal values for the /STRUCTURE qualifier
   are 1
   and 2.

   User Action: Correct the command. Specify either 1 or 2 for the
   /STRUCTURE qualifier.

BADSUBFCN

invalid subfunction received

   Facility: DTR, DECnet Test Program Protocol

   Explanation: The DECnet-VAX test program has a protocol
   incompatibility.

   User Action: Run the test against a compatible version of DTRECV
   or an equivalent.

BADSWPVBN

swap VBN specified for non-process page

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADSYM

unknown symbol 'symbol-name'

   Facility: SDA, System Dump Analyzer

   Explanation: The SDA cannot identify a specified symbol.

   User Action: Correct the spelling of the symbol.

BADSYMTAB

bad symbol table

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The symbol table is invalid.

   User Action: Correct the symbol table.

BADTAGVAL

bad boundry tag value

   Facility: LIB, Library Facility

   Explanation: A call to LIB$FREE_VM has overwitten memory
   locations. Tags are longwords appended to the end of each block
   that store the size of the block. Before a block is freed,
   LIB$FREE_VM checks that these blocks have not been overwritten.

   User Action: Modify your program to ensure that it writes only to
   the memory locations that it has access to.

BADTARGET

target location protected, cannot perform deposit

   Facility: DEBUG, VMS Debugger

   Explanation: The target address of the DEPOSIT command cannot be
   made writable. The DEPOSIT command cannot be performed.

   User Action: None.

BADTIME

'time-spec' is an invalid time specification

   Facility: Shared by several facilities

   Explanation: An invalid time specification is entered.

   User Action: Respecify the time specification using the rules
   listed in the VMS DCL Dictionary.

BADTYPE

invalid file type in startup file

   Facility: START, System Startup Driver

   Explanation: A startup component file in the startup component
   database has a file type which is not COM or EXE.

   User Action: Use the SYSMAN command STARTUP MODIFY FILE to correct
   the file name.

invalid sink type 'sink-name', record ignored

   Facility: EVL, Event Logger

   Explanation: The event receiver received an event record that had
   an invalid sink type. The record is ignored.

   User Action: None. This message displays the name of the sink.


BAD_TYPE

invalid sort process specified

   Facility: SORT, Sort/Merge Utility

   Explanation: You passed one of the following sort type codes to
   the routine package:

   o  Less than 1 or greater than 4 if file I/O

   o  Not equal to 1 if record I/O

   o  An invalid key word in command /PROCESS

   Legal values are 1 through 4 for file I/O; 0 for record I/O; and
   RECORD, TAG, INDEX, or ADDRESS for the /PROCESS command parameter.

   User Action: Specify a different sorting process.

BADUIC

invalid UIC syntax

   Facility: MOUNT, Mount Utility and INIT, INITIALIZE Command

   Explanation: The command contains an invalid UIC. The group and
   member portions of a UIC must both be specified and separated by a
   comma.

   User Action: Reenter the command; use the DCL command HELP or
   refer to the VMS DCL Dictionary for the correct syntax.

BADUSERDESC

descriptor from user routine invalid or memory inaccessible

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The routine called from CALL_USER incorrectly filled
   in the return descriptor. It either is not a valid VAX descriptor
   or references memory that is not accessible by your access mode.

   User Action: For information on how to use descriptors, refer to
   the Introduction to VMS System Routines.

BADUSR

username does not exist

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The user name you specified does not exist in the
   system user authorization file (SYSUAF.DAT).

   User Action: Correct the user name and reenter your command. You
   can display the records in the user authorization file by using
   the AUTHORIZE command SHOW.

BADUSRDAT

connect/disconnect userdata invalid

   Facility: DTS, DECnet Test Program Protocol

   Explanation: This message indicates a test error.

   User Action: Retry the test.

BADUSRLEN

connect/disconnect userdata is wrong length

   Facility: DTS, DECnet Test Program Protocol

   Explanation: This message indicates a test error.

   User Action: Retry the test.

BADVALUE

error in value specification

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You specified an incorrect value.

   User Action: See the VMS Authorize Utility Manual for information
   on value specifications.

illegal qualifier value

   Facility: CDU, Command Definition Utility

   Explanation: Either the qualifier value in the command string is
   invalid or the qualifier value in the CLD file is incorrect.

   User Action: Either enter a valid qualifier value in the command
   string or modify the qualifier value contained in the CLD file.

illegal qualifier value

   Facility: MESSAGE, Message Utility

   Explanation: An illegal numeric value has been used in one of
   several contexts within a MSG file (for example, bad facility
   numbers, bad base numbers, or a bad FAO count).

   User Action: Replace the illegal value with one within the valid
   range.

integer value 'integer' is outside of specified limits

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The argument that you supplied is outside of the
   valid boundaries.

   User Action: Reenter your command with a valid integer value for
   the argument.

'value' is an invalid keyword value

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: DSR encountered an invalid keyword value.

   User Action: Specify the correct value and reenter the command.

'value' is an invalid keyword value

   Facility: Shared by several facilities

   Explanation: An invalid value is specified for the indicated
   command qualifier.

   User Action: Check the command string for a spelling or syntax
   error. Verify the values or syntax and reenter the command.






BADVEC

invalid change mode or message vector

   Facility: SYSTEM, VMS System Services

   Explanation: This severe error message is associated with a status
   code returned from a system service request. An invalid change
   mode or message vector is encountered.

   User Action: Correct the change mode or message vector.

BADVOL1

bad VOL1 ANS label

   Facility: MOUNT, Mount Utility and INIT, INITIALIZE Command

   Explanation: The protection encoded on a magnetic tape volume
   label is invalid or the label itself is invalid; the magnetic tape
   ACP cannot process the tape. The tape is defective, it is not an
   ANSI-labeled tape, or the hardware device is not reading the tape
   properly.

   User Action: Verify the tape volume. If necessary, mount the tape
   as a foreign volume and try to read it.

BADVOLACC

invalid value on /LABEL:VOLUME_Accessibility qualifier

   Facility: INIT, INITIALIZE Command

   Explanation: An invalid ANSI "a" character is specified in the
   volume accessibility field of the tape volume label. For example,
   the following command specifies an invalid ANSI "a" character-a
   dollar sign ($):

   $ INITIALIZE/LABEL:VOLUME_ACCESSIBILITY:$

   User Action: Specify a valid ANSI "a" character in the single-
   character field of the command. The set of valid ANSI "a"
   characters includes: digits 0..9, uppercase A..Z, space, and !
   " % & ' ( ) * + ,-. / : ; < => ?

BADVOLLBL

invalid value for ANSI tape volume label

   Facility: INIT, INITIALIZE Command

   Explanation: You used one or more invalid ANSI "a" characters in
   the volume label. The set of valid ANSI "a" characters includes:
   digits 0..9, uppercase A..Z, space, and ! " % & ' ( ) * + ,-. / :
   ; < => ?

   User Action: Respecify the command with valid ANSI "a" characters.

BADWATCH

cannot watch protect address 'address-value'

   Facility: DEBUG, VMS Debugger

   Explanation: A SET WATCH command specified a protected address.
   Note that you cannot place a watchpoint on a dynamically allocated
   variable because these variables are stored on the stack.

   User Action: Do not use watchpoint on this address.

BADWCBPT

bad WCB pointer in IRP

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BADWIDTHCHANGE

terminal will not support change of width

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Window widths may not be changed on non-DEC terminals
   or terminals without advanced video.

   User Action: Use a different terminal or do not change window
   widths.

BADWINDADJUST

attempt to make window less than 1 line long, no adjustment

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have attempted to use the built-in procedure
   ADJUST_WINDOW to make a window less than one physical screen line
   in length.

   User Action: Check the integer arguments and reenter the values.
   Make the window one or more lines long if there is no status line
   for the window. Make the window two or more lines long if there is
   a status line.

BADWINDLEN

window length = 'integer', must be between 'integer' and 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You specified a window length in an argument to the
   built-in procedure CREATE_WINDOW, which goes beyond the screen's
   physical limits.

   User Action: Try your command again with a valid window length.

BADWORD

invalid data 'xxxx' at 'location'

   Facility: Shared by several facilities

   Explanation: The specified data is invalid at the given location.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BADZONE

bad zone

   Facility: LIB, Library Facility

   Explanation: LIB$SHOW_VM_ZONE, LIB$STAT_VM_ZONE, or LIB$VERIFY_
   VM_ZONE is called with a zone identifier that does not represent
   a valid VM zone. Either the zone or one of its associated data
   structures is invalid.

   User Action: Begin debugging procedures to verify and correct the
   problem.

BASDUERRS

basing image due to errors in relocatable references

   Facility: LINK, Linker Utility

   Explanation: Failure to use the .ADDRESS directive and general
   addressing mode in reference to shareable images. The linker must
   base the shareable images to resolve the references.

   User Action: The image will execute properly; however, you should
   correct the specified references.

BASESYM

base address symbol 'symbol-name' is undefined or relocatable

   Facility: LINK, Linker Utility

   Explanation: A symbol used to specify a base address symbolically
   is not defined or is relocatable.

   User Action: You must use a defined, absolute symbol for
   specifying symbolic base addresses.

BASSHRBEL

shareable image 'image-name' has base of 'address' which is below
image base of 'address'

   Facility: LINK, Linker Utility

   Explanation: A shareable image specified as input in the creation
   of a based shareable image has a lower base address than the
   address specified in the BASE= option.

   User Action: None; however, note that the linker places the input
   shareable image at a lower base address than the address specified
   in the BASE= option.

BATCHNOOPR

no operator available to service batch request

   Facility: MOUNT, Mount Utility

   Explanation: The MOUNT request is aborted because the batch job
   requires operator assistance and no operator is present.

   User Action: Call the operator and retry the request.

BATIS_OFF

batching is off

   Facility: SMG, Screen Management Facility

   Explanation: A program tried to turn off batching when batching is
   already off.

   User Action: Make sure that there is one call to turn on batching
   for each call to turn it off.

BATIS_ON

batching is on

   Facility: SMG, Screen Management Facility

   Explanation: A program tried to turn on batching when batching is
   already on. This is normal in a modular environment.

   User Action: Make sure that there is one call to turn off batching
   for each call to turn it on.

BATSTIPRO

batching is still in progress

   Facility: SMG, Screen Management Facility

   Explanation: A user tried to end batching (updating) with a call
   to SMG$END_DISPLAY_UPDATE or SMG$END_PASTEBOARD_UPDATE. This
   action did not terminate batching because there were more calls to
   begin batching than to end batching.

   User Action: None. An outer level routine probably still needs
   batching to be in effect.

BBFOVF

bad block file overflow on 'device-name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: This message indicates that during the analysis of
   the medium, the SDBSF became full. It could be as a result of a
   large number of bad blocks specified to the /BAD_BLOCKS qualifier
   or as a result of an unreliable medium.

   User Action: Rerun the ANALYZE/MEDIA command without as many bad
   blocks entered to the /BAD_BLOCKS qualifier, or in the default
   mode of the /NOKEEP qualifier, which will re-create the SDBSF.

BBFWRT

failed to write the bad block file on 'device-name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: Failed to write an updated SDBSF on the media.

   User Action: Examine the associated messages for a clue to the
   problem and correct it if possible. An example of this type of
   error would be updating the bad block file without exercising the
   medium, but the device is write locked.

BBLHEADER

file ('file-id') 'filename' contains suspected bad blocks

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified file
   is marked as containing suspected bad blocks. When the file is
   deleted, the blocks will be verified and returned to the bad block
   file if necessary.

   User Action: If desired, examine the contents of the file and
   reconstruct from backup media as necessary.

BDPPURGERR

buffered datapath purge incomplete

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BEGIN

'string' beginning

   Facility: Shared by several facilities

   Explanation: A program phase is being started.

   User Action: None.

BEGIND

'string' beginning at 'date'

   Facility: Shared by several facilities

   Explanation: A program phase began.

   User Action: None.

BEGINT

'string' beginning at 'time'

   Facility: Shared by several facilities

   Explanation: A program phase began.

   User Action: None.

BEGNLEND

beginning time not earlier than ending time

   Facility: MONITOR, Monitor Utility

   Explanation: Monitoring is requested to begin at a time that
   is the same as or later than the requested end time. This
   error occurs most frequently when specifying a delta time
   specification for the /BEGINNING or /ENDING qualifiers. Delta
   time specifications must always be preceded by a plus or minus
   sign. If a plus sign is used, the entire time specification must
   be enclosed in double quotes. For live monitoring and playback,
   delta time specifications are offset from the current system time.

   User Action: Reenter the MONITOR request with the correct time
   specifications for the /BEGINNING or /ENDING qualifiers.

BEGOFBUF

attempt to move past the beginning of buffer 'buffer-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have attempted to move backward past the first
   character in the buffer. VAXTPU assumes that the current editing
   position is the first character in the buffer.

   User Action: Stop trying to move backward. You are already
   positioned at the beginning of the buffer.

BEGOFFILE

beginning of file

   Facility: SYSTEM, VMS System Services

   Explanation: A backspace operation backed up to the beginning of
   the file.

   User Action: If you are reading backwards or backspacing a
   tape, this message indicates that the end-of-the-data area has
   been reached. Modify the program to recognize and correct this
   condition.

BEGRAN

requested beginning time beyond range of input file

   Facility: MONITOR, Monitor Utility

   Explanation: Monitoring of an input recording file is requested to
   begin at a time later than the ending time indicated in the file.
   This error occurs most frequently when a delta time is specified
   in the /BEGINNING qualifier. Delta time specifications must always
   be preceded by a plus or minus sign. If a plus sign is used, the
   entire time specification must be enclosed in double quotes. For
   both live monitoring and playback, delta time specifications are
   offset from the current system time.

   User Action: Reenter the MONITOR command with the correct time
   specifications for the /BEGINNING qualifier.

BES

bad escape sequence

   Facility: RMS, VMS Record Management Services

   Explanation: A terminal escape sequence is invalid.

   User Action: The characters read up to the escape sequence are
   returned in the user record buffer. Modify the program to detect
   and respond to the condition, or reenter the input specifying the
   correct escape sequence.

BIIC failure-BICSR/BER/CNF 'xxxxxxxx/xxxxxxxx/xxxxxxxx'

   Facility: VAXport, VAXport Driver

   Explanation: The port driver attempts to reinitialize the port;
   after 50 failed attempts it marks the device off line.

   User Action: Call DIGITAL field service to check the port
   hardware.

BINARYOPER

operand combination 'type' 'oper' 'type' unsupported

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The specified operator does not support the specified
   data type combination.

   User Action: Use only supported data types with the operator.

BINCHKSUM

a binary record failed checksum in 'record'

   Facility: EXCHANGE, Exchange Utility

   Explanation: While reading a formatted-binary record, the Exchange
   Utility found a record whose computed checksum did not match the
   actual checksum stored in the record.

   User Action: EXCHANGE ignores this error and copies the file as if
   all the checksums are correct. If the output file is a formatted-
   binary file, the checksum in the output record is correct. Make
   sure that the output file is usable.

BINRECFMT

an illegal binary record found in 'filename'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility found a record in the named file
   which is not a valid formatted-binary record.

   User Action: Retry the command after checking whether the file is
   really a PDP-11 formatted binary file. If it is not a binary file,
   use the correct /RECORD_FORMAT qualifier. For example, the console
   file CI780.BIN is assumed to be a formatted binary file, since it
   has the file type BIN. CI780.BIN is really a fixed-length file, so
   it should be copied with a /RECORD_FORMAT=FIXED qualifier.

BITMAPERR

I/O error on storage bitmap; volume locked

   Facility: MOUNT, Mount Utility

   Explanation: An I/O error is encountered during a mount operation.
   Existing files on the volume can be accessed but other operations,
   for example, CREATE and DELETE, are not possible.

   User Action: Repair the volume with the Verify Utility.

BITMAPINV

storage bitmap is invalid, volume locked

   Facility: MOUNT, Mount Utility

   Explanation: The volume's storage bit map contains invalid data.

   User Action: Use the Verify Utility to repair the bit map.

BITRANGE

bit range out of limits

   Facility: DEBUG, VMS Debugger

   Explanation: The EVALUATE command specified a bit field that is
   too wide.

   User Action: The low limit of the bit field is 0 and the high
   limit is 31; the maximum range is 31:0.

BKS

bucket size too large (FAB)

   Facility: RMS, VMS Record Management Services

   Explanation: The bucket size specified in the FAB is larger than
   63. If the bucket size is specified as zero, the maximum record
   size is too large.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. Refer to the formulas and rules for calculating bucket
   size in the VMS Record Management Services Manual.

BKZ

inconsistent bucket size for area id = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The bucket size field specified in an allocation XAB
   is larger than 63 or is too small for the record size.

   User Action: The status value (STV) field of the FAB provides the
   area identification of the XAB in error. Verify that the call to
   the VMS RMS service is coded correctly. Refer to the formulas and
   rules for calculating bucket size in the VMS Record Management
   Services Manual.

BLK0BAD

block 0 is bad, do not use 'device-name' as a system device

   Facility: BAD, Bad Block Locator Utility

   Explanation: Block zero (0) is defective on the medium.

   User Action: Do not use the medium as a system device, because
   block zero is used to contain the boot strap.

BLKDIRSYNX

block directive syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A conditional block or a repeat block directive
   contained a syntax error.

   User Action: Correct the directive syntax.

BLKEXPNABS

block expression not absolute

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The expression specifying the amount of storage to be
   allocated in a .BLKA, .BLKB, .BLKD, .BLKF. .BLKG, .BLKH, .BLKO,
   .BLKQ, OR BLKW directive contained an undefined symbol or is a
   relative expression.

   User Action: Replace the expression with an absolute expression
   that does not contain any undefined symbols.

BLKZERO

block zero is bad; volume not bootable

   Facility: INIT, INITIALIZE Command

   Explanation: This message is generated by the DCL command
   INITIALIZE as a warning message. The volume cannot be bootstrapped
   on a PDP-11. The volume is usable on a VMS system disk.

   User Action: Note that the volume probably cannot be used as a
   system volume for a VAX-11 processor model that requires access to
   the boot block during a bootstrap operation.

block zero of 'device-name' is bad-volume not bootable

   Facility: BACKUP, Backup Utility

   Explanation: The boot block of the specified volume is not usable.

   User Action: Note that the volume probably cannot be used as a
   system volume for a VAX-11 processor model that requires access to
   the boot block during a bootstrap operation.


BLN

invalid block length for control block (RAB/FAB)

   Facility: RMS, VMS Record Management Services

   Explanation: An invalid value is specified in a VMS RMS FAB or RAB
   block length field.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. Specifically, ensure that the control block is properly
   initialized and that the block length field is not modified after
   initialization.

BLOCKCHECK

block check, please report error 'error' and the following: address
= 'number', size (found,expected) = 'size' type = 'type'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered a control block of
   an unexpected format, and has terminated.

   User Action: Please submit a Software Performance Report,
   including the error number and other information, and the commands
   which resulted in the message. If the error is only reproducible
   using a particular piece of media, please send a copy of the media
   with the SPR (use BACKUP /PHYSICAL to make the copy).

BLOCKCHECK0

block check, please report error 'error'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility failed to find a control block
   when one is expected, and has terminated.

   User Action: Please submit a Software Performance Report,
   describing the error number and the commands which resulted in
   the message. If the error is only reproducible using a particular
   piece of media, please send a copy of the media with the SPR (use
   BACKUP /PHYSICAL to make the copy).

BLOCKCNTERR

block count error

   Facility: SYSTEM, VMS System Services

   Explanation: The message indicates that the number of blocks read
   differs from the number of blocks recorded in the trailer labels
   when a file that is opened for a read operation is deaccessed.

   User Action: This message indicates that either a noise record is
   read or a valid record is not read. Either the magnetic tape is
   defective or a hardware problem exists. Mount the magnetic tape on
   another drive/controller and perform the same operation again. If
   the problem persists, the magnetic tape is probably defective.

BLOCKCRC

software block CRC error

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the block CRC field of
   a save set block. Data in the save set is corrupted.

   User Action: None. Save set data has been lost.

BLOCKLOST

block of 'filespec' lost due to unrecoverable error

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an irrecoverable error
   in reading the specified save set and cannot correct the error
   using the redundancy information.

   User Action: None. Save set data has been lost.

BLPRSP

bad loopback response

   Facility: NCP, Network Control Program

   Explanation: A loopback message did not match either the length or
   content that the system expected.

   User Action: Use another form of testing to determine why the
   loopback failed.

BMS

bad margin specification: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: An illegal value is used for a margin setting.

   User Action: Correct the margin setting in the input file.

BOF

beginning of file detected

   Facility: RMS, VMS Record Management Services

   Explanation: During a backspace operation, the file is positioned
   at the beginning of the file before the specified number of blocks
   is backspaced. The status value (STV) field in the FAB or RAB
   contains the number of blocks actually spaced.

   User Action: This is a warning status. Modify the source program,
   if necessary, to detect and respond to the condition.

BOOT-F-Bootfile not contiguous

   Facility: VMB, Virtual Memory Boot

   Explanation: The file [SYSEXE]SYSBOOT.EXE is located but is not
   contiguous.

   User Action: The disk you are attempting to bootstrap cannot be
   bootstrapped. Obtain another copy of the system disk.

BOOT-F-Failed to initialize device

   Facility: VMB, Virtual Memory Boot

   Explanation: Encountered an error in the load path while VMS was
   trying to initialize the boot device,

   User Action: Try initializing again. If this fails, call DIGITAL
   field service.

BOOT-F-I/O error reading boot file

   Facility: VMB, Virtual Memory Boot

   Explanation: An uncorrectable read error occurred while the file
   [SYSEXE]SYSBOOT.EXE is being read.

   User Action: Try rebooting the disk. If subsequent attempts fail,
   obtain another copy of the system disk.

BOOT-F-Nonexistent drive

   Facility: VMB, Virtual Memory Boot

   Explanation: The specified drive number does not exist.

   User Action: Specify an appropriate device unit to the console
   program, or use a different console bootstrap command procedure.

BOOT-F-Unable to locate BOOT file

   Facility: VMB, Virtual Memory Boot

   Explanation: The file [SYSEXE]SYSBOOT.EXE could not be found.

   User Action: You are attempting to bootstrap a volume that does
   not contain a VMS binary system. Attempt to reboot using an
   appropriate disk volume.

BOOT-F-Unexpected exception

   Facility: VMB, Virtual Memory Boot

   Explanation: An unexpected exception occurred while the primary
   bootstrap (VMB.EXE) is being executed. This condition probably
   indicates a corrupted SYSBOOT.EXE file or a hardware failure.

   User Action: Determine the source of the error, and either obtain
   a new copy of the system disk or call your local field service
   representative.

BOOT-F-Unexpected machine check

   Facility: VMB, Virtual Memory Boot

   Explanation: An unexpected machine check occurred while the
   primary bootstrap (VMB.EXE) is being executed. This condition
   probably indicates a corrupted SYSBOOT.EXE file or a hardware
   failure.

   User Action: Determine the source of the error, and either obtain
   a new copy of the system disk or call your local field service
   representative.

BOTLINETRUNC

calculated new last line 'integer', changed to 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have adjusted a window. The new last line of the
   window, however, would have been greater than the actual number of
   physical screen lines. Therefore, VAXTPU has calculated the number
   of available screen lines and truncated the window accordingly.

   User Action: None is required. However, you may reexecute the
   built-in procedure ADJUST_WINDOW with different arguments.

BRDCST

unable to write to console device 'sink-name'

   Facility: EVL, Event Logger

   Explanation: An error occurred while writing to the console sink.
   The event is discarded. This message displays the name of the
   console.

   User Action: None.

BRDESTRANG

branch destination out of range

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The address specified in the branch instruction
   is too far from the current PC. Branch instructions with byte
   displacements have a range of -128 bytes to +127 bytes from the
   current PC. Branch instructions with word displacements have a
   range of -32768 bytes to +32767 bytes from the current PC.

   User Action: Use a branch instruction with a word displacement
   instead of one with a byte displacement; use a jump (JMP)
   instruction instead of a branch instruction; or change the program
   logic so that the branch destination is closer to the branch
   instruction.

BRDMSGLOST

broadcast queue pointer has no related entry

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

BREAK

breakpoint fault at PC location, PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: A breakpoint instruction is encountered. This message
   indicates an exception condition that is not handled by the
   condition handler and is usually followed by a display of the
   condition arguments, registers, and stack at the time of the
   exception.

   User Action: Examine the PC and virtual address displayed in the
   message to correct the instruction that caused the error.

BRKNLIB

library 'library-name' not properly closed, compress or rebuild

   Facility: LIBRAR, LIBRARY Command

   Explanation: An error occurred during a previous update to the
   library that interrupted the write operation, leaving the library
   in an inconsistent state.

   User Action: This library can no longer be modified, but it can be
   read. Uncorrupted data can be reclaimed by compressing the library
   or by extracting modules and re-creating a new library.

BRTOOFAR

destination 'addr' is too far for branch operand

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: If the Patch Utility generated this message, the
   relative displacement for the branch instruction is not large
   enough to reach the specified destination address. If the debugger
   generated this message, the DEBUG command DEPOSIT specified a
   branch instruction with a destination, addr, too far from the
   current PC.

   User Action: If the Patch Utility generated this message, correct
   the destination address and retry the operation. If the debugger
   generated this message, change a BRB instruction to BRW or a BRW
   to JMP or specify a closer address.

BUFBLKREQ

buffer count or block count required

   Facility: SET, SET Facility

   Explanation: You specified either the /BLOCKS_COUNT or
   /BUFFER_COUNT qualifier (with the SET RMS command) without
   specifying numeric values.

   User Action: Reenter the command and qualifier specifying a
   numeric value for the qualifier.

BUFBYTALI

device does not support byte-aligned transfers

   Facility: SYSTEM, VMS System Services

   Explanation: Some devices do not support buffers that are not
   aligned on word boundaries or byte counts that are not an even
   number.

   User Action: Recode the program using the .ALIGN macro directive
   or change the byte count to an even number.

BUFFEROVF

buffer overflow

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).

output buffer overflow

   Facility: SYSTEM, VMS System Services

   Explanation: An output string returned by a system service is
   larger than the user buffer provided to receive the string, and
   the string is truncated.

   User Action: Reenter the QIO with a larger buffer or ignore the
   error if you have received enough information.

output buffer overflow

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont format
   routine indicating buffer overflow has been detected.

   User Action: None.



BUFFERSLOST

all buffers are lost

   Facility: BACKUP, Backup Utility

   Explanation: A software error occurred in the Backup Utility.

   User Action: Submit a Software Performance Report (SPR).

BUFNOTALIGN

buffer incorrectly aligned

   Facility: SYSTEM, VMS System Services

   Explanation: A table, list, or buffer area is not correctly
   aligned.

   If this message is associated with a status code returned by a
   request to a DR32 interface, the command block address in the Data
   Transfer Command Table is not quadword aligned (only for start
   data transfer functions).

   If this message is associated with a status code returned by
   a request to a LPA11-K driver and this error occurs for an
   initialize LPA11-K request, the initialize command table is not
   word-aligned.

   If this error occurs for a start data transfer request, there are
   several possible causes:

   o  User status word (USW) not word-aligned

   o  Buffer area not longword-aligned

   o  Random Channel List (RCL) not word-aligned

   User Action: Determine which data area is incorrectly aligned and
   align it on the appropriate boundary, that is, word, longword, and
   so forth.

BUFOVF

command buffer overflow-shorten expression or command line

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command string, including continuation lines, is
   longer than the buffer used by the command interpreter to store a
   command.

   User Action: Shorten and reenter the command; possibly enter more
   than one command.

BUFOVFL

buffer overflow for output file name string

   Facility: PPL, Parallel Processing Facility

   Explanation: Buffer could not contain the complete output string.

   User Action: Recode to pass a larger buffer.

BUFOVR

internal error-Packet has overflowed buffer

   Facility: SMI, System Management Intergator/Server

   Explanation: The packetizer has produced a buffer larger than 4096
   bytes.

   User Action: Submit a Software Performance Report showing all
   SYSMAN commands leading to this error. Also submit the output of a
   SHOW CLUSTER command.

BUG

internal RMS error condition detected

   Facility: RMS, VMS Record Management Services

   Explanation: This message indicates an internal software error
   occurred in VMS RMS.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BUGCHECK

internal consistency failure

   Facility: SYSTEM, VMS System Services

   Explanation: The operating system noted an internal software
   failure.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BUG_DAP

Data Access Protocol error detected; DAP code = 'xxxxxxxx'

   Facility: RMS, VMS Record Management Services

   Explanation: A Data Access Protocol (DAP) violation is detected
   either by VMS RMS or by the File Access Listener (FAL) at the
   remote node during a DECnet-VAX file access operation.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BUG_DDI

invalid default directory

   Facility: RMS, VMS Record Management Services

   Explanation: An internal software error occurred in VMS RMS.

   User Action: Collect as much information as possible and submit a
   Software Performance Report (SPR).

BUSY

a busy signal is detected on the phone line

   Facility: DTK, DECtalk Facility

   Explanation: The routine DTK$DIAL_PHONE is called to dial a phone
   number and the line is busy.

   User Action: Try calling again.

user structure (FAB/RAB) still in use

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS operation is executed from an AST routine
   while the specified FAB or RAB is still in use from non-AST level,
   or the user called VMS RMS illegally from executive mode at
   AST level or from kernel mode and interrupted another VMS RMS
   operation.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. Use multiple I/O streams or include $WAIT requests as
   necessary. Because the control block is still in use, no STS or
   STV value can be returned in the FAB or RAB, so this status value
   is returned only in R0.


BVN

missing or illegal variable name: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The name specification for a DSR command (.VARIABLE,
   .IF, .IFNOT, .ENDIF, or .ELSE) is missing or illegal.

   User Action: Supply the missing specification, or check to see
   that it is typed correctly.

BVP failure-Status/Error/Data 'xxxxxxxx/xxxxxxxx/xxxxxxxx'

   Facility: VAXport, VAXport Driver

   Explanation: The port driver attempts to reinitialize the port;
   after 50 failed attempts, it marks the device off line.

   User Action: Call DIGITAL field service to check the port
   hardware.

BVP timeout-Status/Error/Data 'xxxxxxxx/xxxxxxxx/xxxxxxxx'

   Facility: VAXport, VAXport Driver

   Explanation: The port driver attempts to reinitialize the port;
   after 50 failed attempts, it marks the device off line.

   User Action: Call DIGITAL field service to check the port
   hardware.
Cables have gone from CROSSED to UNCROSSED

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: None.

Cables have gone from UNCROSSED to CROSSED

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: Check for crossed-cable pairs.

CACLS

the 'class-name' class cannot be added to this report

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The class name entered does not apply to the
   currently selected report and, therefore, cannot be added to the
   report. The name is, however, valid in a different report.

   User Action: Select a different report or enter the HELP CLASSES
   command to get a list of available classes.

CAFINVGROUP

group number is invalid or out of range

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A CONFIGURATION SET CLUSTER_AUTHORIZATION command
   specified an invalid group number.

   User Action: Reenter the command with a numeric group number
   between 1 and 65535.

CAFNEITHER

neither GROUP nor PASSWORD given-no action taken

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A CONFIGURATION SET CLUSTER_AUTHORIZATION command do
   not supply either a group number or a password.

   User Action: Reenter the command with the /GROUP or /PASSWORD
   qualifiers, or both, as necessary.

CAFNOTCLU

*Warning*-Environment not CLUSTER- check all system disks for
consistency

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A CONFIGURATION SET/SHOW CLUSTER_AUTHORIZATION
   command is entered in a non-CLUSTER environment. To ensure
   consistency of the CAF database throughout the cluster, these
   commands should normally be entered from a CLUSTER environment.

   User Action: Change the environment and reenter the command, if
   desired.

CAFOLDGROUP

existing group will not be changed

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A CONFIGURATION SET CLUSTER_AUTHORIZATION command
   specified a new password but did not specify a new group number.
   The old group number is retained.

   User Action: None, if the group number is correct.

CAFOLDPASS

existing password will not be changed

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A CONFIGURATION SET CLUSTER_AUTHORIZATION command
   specified a new group number but did not specify a new password.
   The old password is retained.

   User Action: None, if the password is correct.

CAFPASSLEN

password is null or too long

   Facility: SYSMAN, Cluster System Management Utility and CAF,
   Cluster Authorization File Service

   Explanation: A CONFIGURATION SET CLUSTER_AUTHORIZATION command
   specified an invalid password.

   User Action: Reenter the command with a valid password.

CAFREBOOT

cluster authorization file updated. The entire cluster should be
rebooted.

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: When you update the CAF, you must reboot the cluster.

   User Action: Reboot the cluster.

CALLOVER

stack overflow

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A nested procedure call caused the program to exceed
   the maximum call depth of 100.

   User Action: Recode the program so that the nesting depth is less
   than 100.

CALLUSERFAIL

CALL_USER routine failed with status %X 'status'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The CALL_USER routine returned the indicated failure
   status.

   User Action: Your action depends on the routine returned.

CANCEL

I/O operation canceled

   Facility: SYSTEM, VMS System Services

   Explanation: An input or output operation was canceled by the
   $CANCEL system service before it started. Usually, the image
   cancels the request. The operating system does not normally
   display this message. If this message is associated with a status
   code returned by a request to a DR11-W interface and if the
   $CANCEL system service is requested while a block mode request
   is active, then the driver performs a device reset to the DR11-W.

   User Action: None.

CANCELED

command is canceled by keyboard action

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility received a CTRL/C key sequence
   while processing a command; it canceled the command and returned
   to the prompt.

   User Action: None.

CANCELQUIT

QUIT canceled by request

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Execution of the built-in procedure QUIT is canceled
   when you respond "no" to the REALLYQUIT question.

   User Action: None.

Cannot set terminal type from change mode

   Facility: EDT, EDT Editor

   Explanation: You attempted to enter a SET TERMINAL
   {VT100|VT52|HCPY} command while working in a screen mode.

   User Action: To change the terminal type with the SET TERMINAL
   command, you must shift to line mode.

CANNOTUNSEL

cannot unselect item from unselect action routine

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You tried to unselect the global selection within
   the action routine called when the global selection is being
   unselected.

   User Action: The global item is already unselected; remove the
   code which attempts to unselect it again.

CANT_BIND

can't initialize device

   Facility: LATCP, LAT Control Program

   Explanation: The LAT device cannot be initialized.

   User Action: Specify an appropriate application or a dedicated
   port.

CANTACCESSMAIN

cannot access the main debugger

   Facility: DEBUG, VMS Debugger

   Explanation: The kernel debugger (DEBUG.EXE) cannot access the
   main debugger (DEBUGSHR.EXE).

   User Action: Correct the problem given by the messages
   accompanying this message. If you cannot solve the problem, submit
   a Software Performance Report (SPR).

CANTBAL

can't balance last page

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: An internal error has occurred.

   User Action: Submit a Software Performance Report (SPR). Please
   include the file that caused the error.

CANTEXPREG

cannot expand virtual address space

   Facility: BACKUP, Backup Utility

   Explanation: Standalone BACKUP attempted unsuccessfully to expand
   its virtual address space.

   User Action: If this error can be reliably reproduced, the BACKUP
   command used and a description of the circumstances should be
   submitted along with a Software Performance Report (SPR).

CANTGETFID

cannot get file-id for image file opened on channel 'channel-number'

   Facility: DEBUG, VMS Debugger

   Explanation: An error occurred while trying to get the file
   identification of the image file opened on channel 'channel-
   number'.

   User Action: Correct the problem given by the messages following
   this message. If you cannot solve the problem, submit a Software
   Performance Report (SPR).

CANTLOCK

cannot lock pages into memory. If the system disk goes off line,
reboot

   Facility: BACKUP, Backup Utility

   Explanation: Standalone BACKUP could not lock the required pages
   into the working set.

   User Action: Normally, no action is necessary. However, if the
   system disk goes off line, it will be necessary to reboot the
   system. The operation of standalone BACKUP is likely to be very
   slow because there is insufficient memory to lock down a small
   portion of the working set.

CANTLOCMAC

can't locate macro in macro libraries

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A macro name specified in an .MCALL directive is not
   defined in the macro libraries searched.

   User Action: Specify the macro library that defines the macro in
   the DCL command MACRO.

CAPTINT

captive account - interactive access denied

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Interactive access (in other words, access to the "$"
   prompt) is not allowed for captive accounts.

   User Action: There is an error in the captive login command
   procedure that has been established for this account, causing
   it to end unintentionally. Or, the captive login command procedure
   has not been set up correctly for this account. See your system
   manager to have the situation corrected.

CAPTINQ

captive account - inquire command not valid

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The INQUIRE command is not valid for captive
   accounts.

   User Action: See your system manager to have the INQUIRE command
   removed from the login command procedure and replaced with the
   READ/PROMPT command.

CAPTIVE

this command cannot be executed; Your account is CAPTIVE

   Facility: MAIL, Mail Utility

   Explanation: You attempted to enter a SPAWN command, and your
   account is CAPTIVE.

   User Action: Contact your system manager if your your account
   should not be CAPTIVE.

unable to create a subprocess in a captive account

   Facility: VAXTPU, VAX Text Processing UtilityandREM, Set Host
   Facility

   Explanation: Captive accounts are not allowed unrestricted access
   to CLIs, which the SPAWN or CREATE_PROCESS built-ins would allow.

   User Action: Do not use the SPAWN or CREATE_PROCESS built-ins from
   a captive account.


CARDS

cards

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued when operator status is
   requested either explicitly by the REPLY/STATUS command or
   implicitly as with the REPLY/ENABLE command. It indicates that the
   operator's terminal is enabled for the "CARDS" class operations.

   User Action: None.

CASETOOLARGE

CASE limits distance too large

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Your CASE statement contains FROM . . . TO limits that
   exceed the maximum number allowed.

   User Action: Break your CASE statement range into multiple,
   smaller CASE statements.

CBT

insufficient contiguous space, file copied noncontiguously

   Facility: Shared by several facilities

   Explanation: There is insufficient disk space to copy the file
   contiguously; the file is copied, but the output file may not be
   contiguous.

   User Action: None.

CCF

cannot close file

   Facility: RMS, VMS Record Management Services

   Explanation: The system could not close an output file during a
   call for I/O run-down.

   User Action: The user-specified buffer contains the device,
   directory, and file identifications of the file that could not
   be closed. Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

CCR

cannot connect RAB

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS could not connect a record access block
   (RAB) to the specified file access block (FAB). This error usually
   results from one of the following actions:

   o  Specifying block I/O (setting the RAB$V_
      BIO option of the RAB$L_ROP field) with
      multistreaming (setting the FAB$V_MSE option of the
      FAB$B_SHR field)

   o  Attempting to connect multiple RABs to a FAB when the
      multistreaming option (FAB$V_MSE) of the file sharing field
      (FAB$B_SHR) has not been set

   o  Attempting a DECnet operation when the multistreaming option is
      set

   The multistreaming option is not supported for DECnet operations.

   User Action: Modify the program. Do not attempt to use unsupported
   operations.

CDA

cannot deliver AST

   Facility: RMS, VMS Record Management Services

   Explanation: Either the applications program exceeds its AST
   quota, or not enough system dynamic memory is available for VMS
   RMS to deliver an error or successful completion AST, and the
   applications program has disabled resource wait mode.

   User Action: The status value (STV) field in the FAB or RAB
   contains the system status code of the operation that provides
   additional information about the condition. Take corrective action
   based on this status code. Raise the process's AST quota and
   modify the source program, if necessary, to detect and respond
   to the condition.

CEBREFNEG

negative reference count on shared memory CEB

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

CEM

comma expected, missing: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A required comma is missing from the command string.

   User Action: Supply the missing comma.

CENTRL

central

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued when operator status is
   requested either explicitly by the REPLY/STATUS command or
   implicitly as with the REPLY/ENABLE command. It indicates that
   the operator's terminal is enabled for "CENTRAL" class operations.

   User Action: None.

CHAINW

chained write status

   Facility: SYSTEM, VMS System Services

   Explanation: The block just received by the 3271 Protocol Emulator
   is part of a chained write sequence.

   User Action: Normally, the information received by the 3271
   Protocol Emulator in a chained write sequence is appended to the
   information received in the previous sequence. Your action will
   vary for each application.

CHAN

error assigning or deassigning channel

   Facility: CNF, NI Configurator

   Explanation: An error occurred while assigning or deassigning a
   channel.

   User Action: See the accompanying message to determine the
   appropriate action.

CHANGE_INV

selected change of state is not permitted

   Facility: LMCP, Log Manager Control Program

   Explanation: An attempt was made to change the transaction state,
   with the REPAIR subcommand, using an invalid transition. Valid
   transitions include: PREPARE to COMMIT, PREPARE to ABORT, and
   COMMIT to FORGET.

   User Action: See the REPAIR command description in the LMCP
   documentation.

Change mode can be entered only from a terminal

   Facility: EDT, EDT Editor

   Explanation: You cannot enter change mode (keypad, nokeypad, or
   hardcopy change mode) from a network, a batch command file, or a
   startup command file.

   User Action: Use the EDT command SET MODE CHANGE in the startup
   file to make EDT enter change mode at the end of the startup file.

'Character-name' required

   Facility: EDT, EDT Editor

   Explanation: The command requires the specified character.

   User Action: Reenter the command including the required character.

CHG

invalid key change in $UPDATE (CHG not set)

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $UPDATE operation specified a record that
   contained one or more changed key values for keys that do not have
   the 'keys may change' attribute set in the XAB key option flag.

   User Action: Either reorganize the file and specify the 'keys
   may change' attribute to be set in the XAB key option flag, if
   necessary, or modify the source program to detect and respond to
   the condition.

CHK

bucket format check failed for VBN = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS detected a corrupted bucket in an indexed
   file. The bucket address check or bucket checksum is incorrect.

   User Action: Reorganize the file, if possible; otherwise, re-
   create the file. The status value (STV) field of the FAB or RAB
   contains the starting virtual block number of the bucket in error.

   This error can be caused by hardware errors, VMS RMS or system
   software errors, or modifications of files by non-RMS programs.
   If RMS errors are suspected, submit a Software Performance Report
   (SPR).

CHKALTHOME

invalid alternate home block, VBN 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the alternate home
   block at the specified virtual block of the index file on the
   specified relative volume is corrupted. The alternate home block
   is refreshed from the primary home block.

   User Action: None.

CHKPRIHOME

invalid primary home block, VBN 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the primary home block
   at the specified virtual block of the index file on the specified
   relative volume is corrupted. The Verify Utility reconstructs the
   block. If the volume can no longer be mounted by the operating
   system, it is corrupted and must be reconstructed from back-up
   media. If the volume can be mounted, the damage can be repaired by
   copying the volume to fresh media.

   User Action: None.

CHKSCB

invalid storage control block, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the storage control
   block on the specified relative volume is corrupted. The Verify
   Utility reconstructs the block. If the volume can no longer be
   mounted by the operating system, it is corrupted and must be
   reconstructed from back-up media. If the volume can be mounted,
   the damage can be repaired by copying the volume to fresh media.

   User Action: None.

CHMONIS

change mode instruction while on interrupt stack

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

CHMVEC

CHM vector bits <1:0> not 0

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

CHN

assign channel system service request failed

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS failed to assign a channel to a device
   specified for an input or output operation. This message is
   usually accompanied by a system message that indicates the reason
   for the failure.

   User Action: The status value (STV) field in the FAB contains the
   system status code that indicates the reason for the failure. Take
   corrective action based on these codes.

   If the error results from the DCL command OPEN, or following
   the DCL command @ (execute procedure) or the DCL command RUN,
   verify that the volume containing the specified file is on line
   and mounted.

CINBAD

connect not accepted/rejected as expected

   Facility: DTS, DECnet Test Program Protocol

   Explanation: This message indicates a test error.

   User Action: Ensure that the correct DTRECV or equivalent is
   available at the target node.

CINREJ

connect aborted, nsp reason is 'number'

   Facility: DTS, DECnet Test Program Protocol

   Explanation: The logical link to DTRECV could not be established.

   User Action: Interpret the Network Services Protocol (NSP) reason.

CIPORT

fatal error detected by VAXport driver (PADRIVER)

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

CIREXLST

command aborted after 'number_of_handlers' exit handlers displayed
circular exit handler list suspected

   Facility: DEBUG, VMS Debugger

   Explanation: After displaying information about 100 exit handlers,
   the debugger suspects that a circular exit handler list exists.

   User Action: If a circular exit handler list exists, then identify
   and correct the error in your program.

CJFERR

journaling error; volume dismounted to ensure data integrity

   Facility: MOUNT, Mount Utility

   Explanation: The attempt to activate the Recovery Unit Journal
   (RUJ) on the volume failed. Because the RUJ might contain an
   active recovery unit, the volume is dismounted to minimize the
   danger of corrupting the data on the volume. This message is
   usually followed by another message that describes the error
   condition that caused RUJ activation to fail.

   User Action: Correct the error conditon and reenter the MOUNT
   command, or reenter the MOUNT command including the /NOJOURNAL
   qualifier. With the latter approach, MOUNT will not attempt to
   activate the RUJ. This approach removes the symptom but not the
   cause of the failure and may leave the volume in an inconsistent
   state.

CJL

can't output line correctly-margins too narrow. Line will not be
justified

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The text and spacing are greater than the number of
   character positions available between the margins.

   User Action: Truncate the line or use the Break flag to divide it.

CLASDISAB

class disabled

   Facility: MONITOR, Monitor Utility

   Explanation: One or more of the specified class-names is not a
   valid MONITOR class.

   User Action: Check the list of valid MONITOR classes by entering
   the DCL command HELP MONITOR. Reenter the MONITOR command
   requesting only valid classes.

CLASMISS

requested class record missing from input file

   Facility: MONITOR, Monitor Utility

   Explanation: The class data records in the input recording file do
   not match information in the header for the file. This can only
   occur if the input file has been corrupted in some way.

   User Action: If you can demonstrate that a MONITOR recording file
   can be created with one MONITOR request, then, using that file as
   input, immediately run a second MONITOR request that produces this
   message. Submit a Software Performance Report (SPR).

CLASNP

some requested classes not present in input file

   Facility: MONITOR, Monitor Utility

   Explanation: One or more of the requested MONITOR classes is not
   present in the input file. This situation may result from having
   specified an incorrect input file with the /INPUT qualifier.

   User Action: The MONITOR request continues execution, monitoring
   only those requested classes that are present in the input
   recording file. If an incorrect input file has been specified,
   reenter the command, specifying the correct input file.

CLASUNK

some requested classes have file structure levels incompatible with
the current version of MONITOR

   Facility: MONITOR, Monitor Utility

   Explanation: One or more of the requested MONITOR classes in the
   specified input recording file has a structure level incompatible
   with the current version of MONITOR. This situation may result
   from reading a file that is created by a version of MONITOR higher
   than the one currently running.

   User Action: No action is required. The MONITOR request will
   continue to execute, monitoring only those requested classes that
   are compatible with the version of MONITOR currently running.

CLIERR

CLI error parsing command line

   Facility: PATCH, Patch Utility

   Explanation: The command line that invokes PATCH is incorrectly
   entered.

   User Action: Reenter the command line correctly.

CLIFAIL

error activating command interpreter 'interpreter'

   Facility: LOGIN, Login Processor

   Explanation: An error occurred while attempting to invoke the
   command interpreter for your process. An accompanying message will
   provide more information.

   User Action: Correct the problem described by the accompanying
   message, and try again.

CLIFRCEXT

CLI forced exit

   Facility: SYSTEM, VMS System Services

   Explanation: The command interpreter forced an image to terminate
   abnormally. This message is displayed by the debugger when an
   image is interrupted by CTRL/Y and another command is entered. The
   debugger displays this message indicating the image is terminated.

   User Action: None. The message is informational.

CLIMISMATCH

CLI type of image does not match /CLI qualifier

   Facility: CDU, Command Definition Utility

   Explanation: CDU returns this message when you try to use the SET
   COMMAND/CLI=CLI-type command to modify command tables created by a
   CLI-type other than the one you have specified.

CLIPBOARDFAIL

unexpected clipboard failure

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An unexpected clipboard failure has occurred.

   User Action: A software error has occurred. Please submit a
   Software Performance Report (SPR).

CLIPBOARDLOCKED

clipboard is locked by another process

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The clipboard is locked by another process.

   User Action: Repeat the clipboard operation after the other
   process has finished with the clipboard.

CLIPBOARDNODATA

clipboard does not contain the requested data

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The clipboard does not contain the requested data.

   User Action: Repeat the clipboard operation after the other
   process has finished with the clipboard.

CLIPBOARDZERO

clipboard data has 0 length

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The data to be written to the clipboard has zero
   length.

   User Action: Only specify nonzero length data to be written to the
   clipboard.

CLIPROT

error protecting command interpreter pages

   Facility: LOGIN, Login Processor

   Explanation: An error occurred while trying to protect the command
   interpreter pages. An accompanying message will provide more
   information.

   User Action: Correct the problem described by the accompanying
   message, and try again.

CLIQUAL

the /CLI qualifier value conflicts with CLI type in tables

   Facility: CDU, Command Definition Utility

   Explanation: The CDU outputs this message when you try to use the
   SET COMMAND/CLI=cli-type command to modify command tables created
   by a CLI-type other than the one you have specified.

   User Action: Specify different command tables, generated by the
   appropriate CLI, or use a different CLI-type in the command.

CLISYMTBL

error creating space for command interpreter symbol table

   Facility: LOGIN, Login Processor

   Explanation: An error occurred while trying to create virtual
   address space for the command interpreter symbol table. An
   accompanying message will provide more information.

   User Action: Correct the problem described by the accompanying
   message, and try again.

CLIWARNMSG

Warning: /CLITABLES field may need to reflect changes to /CLI field

   Facility: AUTHORIZE, Authorize Utility

   Explanation: If you modify the command language interpreter (CLI)
   field of a record in the system user authorization file, you may
   have to modify the CLITABLES field to reflect the change. If you
   have set the CLI field to DCL or MCR, however, the CLITABLES field
   defaults to the correct value.

   User Action: If you have changed the CLI field to a value other
   than DCL or MCR, use the AUTHORIZE command MODIFY/CLITABLES to
   set the CLITABLES field to the corresponding tables. Refer to the
   description of the LOGIN Procedure in the VMS DCL Dictionary for
   further information about specifying CLI tables.

CLOSEDEL

error deleting 'filename'

   Facility: Shared by several facilities

   Explanation: An error occurred while a file is being closed after
   a delete operation. This message is usually accompanied by a VMS
   RMS message indicating the reason for the failure.

   User Action: Take corrective action based on the associated
   message.

CLOSEERR

an error occurred closing 'filename'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility received an error from RMS while
   trying to close a Files-11 file.

   User Action: This message will be followed by one or two error
   messages reporting the actual condition discovered by RMS. Take
   corrective action suggested by the RMS error messages, then retry
   the command.

error closing 'filespec'

   Facility: SET, SET Facility

   Explanation: An error occurred while trying to close a file whose
   characteristics have just been set. This message is accompanied by
   a message explaining why the file could not be closed.

   User Action: Respond to the accompanying message.


CLOSEFILE

error closing event file 'file-id'

   Facility: EVL, Event Logger

   Explanation: An error occurred while closing an event file.

   User Action: None. This message displays the name of the file.

CLOSEFOREIGN

an error occurred closing the volume 'volume'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility received an error from RMS while
   trying to close a connection to a foreign-mounted volume.

   User Action: This message will be followed by one or two error
   messages reporting the actual condition discovered by RMS. Take
   corrective action suggested by the RMS error messages, then retry
   the command.

CLOSEIN

error closing input file

   Facility: Shared by several facilities

   Explanation: During a VMS RMS operation, an error is encountered
   while closing an input file. This message is usually accompanied
   by a VMS RMS message indicating the reason for the failure.

   User Action: Take corrective action based on the associated
   message.

error closing input file 'filespec'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A VMS RMS error occurred while closing the specified
   input file. The message should be accompanied by a VMS RMS message
   indicating the reason for the error.

   User Action: Follow the recovery procedure for the specified VMS
   RMS message.

unable to close input

   Facility: ACCOUNTING, Accounting Utility

   Explanation: During a VMS RMS operation, an error is encountered
   while closing an input file. This message is usually accompanied
   by a VMS RMS message indicating the reason for the failure.

   User Action: Take corrective action based on the associated
   message.



CLOSEJOB

error closing job 'job-name' for user 'user-name' in queue 'queue-
name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error occurred during a $SNDJBC system service
   call attempt to close the job.

   User Action: The accompanying message gives information about the
   failed operation. Correct the problem and retry the upgrade.

CLOSEMON

error disconnecting monitor process 'sink-name'

   Facility: EVL, Event Logger

   Explanation: An error occurred while disconnecting a monitor
   process.

   User Action: None. This message displays the name of the monitor
   program.

CLOSEOUT

error closing output file 'filespec'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A VMS RMS error occurred while closing the specified
   output file. The message should be accompanied by a VMS RMS
   message indicating the reason for error.

   User Action: Follow the recovery procedure for the specified VMS
   RMS message.

error closing output file

   Facility: Shared by several facilities

   Explanation: During a VMS RMS operation, an error is encountered
   while closing an output file. This message is usually accompanied
   by a VMS RMS message indicating the reason for the failure.

   User Action: Take corrective action based on the accompanying
   message.

unable to close output

   Facility: ACCOUNTING, Accounting Utility

   Explanation: During a VMS RMS operation, an error is encountered
   while closing an output file. This message is usually accompanied
   by a VMS RMS message indicating the reason for the failure.

   User Action: Take corrective action based on the accompanying
   message.



CLREFCFER

error clearing UETP common event flag cluster

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   prior to its termination. This error is received in relation to a
   previously displayed error condition.

   User Action: Ignore this error if UETP completed successfully or
   correct the condition leading to this problem and re-run the test.
   If the error persists, submit a Software Performance Report.

CLSERR

close error code of 'xx' on file 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: The $CLOSE request failed due to the error
   represented as xx.

   User Action: Correct the error (represented as xx) and retry.

CLSTBLERR

device class value, 'value' not in class tables

   Facility: ERF, Error Log Utility

   Explanation: The specified class value is unsupported.

   User Action: Submit a Software Performance Report (SPR).

CLUBELBAS

base address of 'address' for cluster 'cluster-name' is below image
base of 'address'

   Facility: LINK, Linker Utility

   Explanation: In the creation of a based shareable image, a cluster
   is specified with a lower base address than the address specified
   in the BASE= option.

   User Action: Specify a base address for the cluster that is higher
   than the address specified in the BASE= option.

CLUEXIT

node Exiting Cluster

   Facility: BUGCHECK, System Bugcheck

   Explanation: To avoid partitioning of the VAXcluster, this system
   exited the VAXcluster by crashing. Generally, this is a normal
   condition. If the condition persists, this processor is most
   probably configured incorrectly into two distinct VAXclusters.
   After all of physical memory is written to a system dump file, the
   system will automatically reboot if the BUGREBOOT system parameter
   is set to 1.

   Explanation: Ensure that the VAXcluster is properly configured.

CLUGDIFF

*Warning*-CAF for node 'nnnnnn' has group 'm'

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A CONFIGURATION SHOW CLUSTER_AUTHORIZATION command is
   entered in a CLUSTER environment, and not all nodes in the cluster
   have the same group number.

   User Action: Enter a CONFIGURATION SET CLUSTER_AUTHORIZATION
   command to ensure that system disks for all members indicate the
   same group number and password.

CLULIST

CLUSTER is invalid with a list of nodes

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: In a SET ENVIRONMENT command, a /CLUSTER qualifier
   cannot be specified if a /NODE qualifier includes more than one
   node. SYSMAN cannot perform clusterwide operations on more than
   one cluster at a time.

   User Action: If a clusterwide environment is desired, it is only
   necessary to specify one node in the cluster, or omit the NODE
   qualifier if the local cluster is desired.

CLUPDIFF

*Warning*-CAF for node 'nnnnnn' has different password

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A CONFIGURATION SHOW CLUSTER_AUTHORIZATION command is
   entered in a CLUSTER environment, and not all nodes in the cluster
   have the same password.

   User Action: Enter a CONFIGURATION SET CLUSTER_AUTHORIZATION
   command to ensure that system disks for all members indicate the
   same group number and password.

CLUSTER

unsuitable cluster factor

   Facility: INIT, INITIALIZE Command

   Explanation: The cluster size specified for a DCL command
   INITIALIZE is either too small or too large for the volume.
   The maximum cluster size for any volume is 1/100 the size of the
   volume; the minimum size is calculated with the following formula:

                                disk_size

                                255*4096

   User Action: Recalculate a cluster size for the volume that is
   within the valid range and reenter the command.

unsuitable cluster factor for 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: During an attempt to initialize an output volume, the
   Backup Utility found that the cluster factor is too large or too
   small for the specified device.

   User Action: If the input is a save set, use the BACKUP/LIST
   command to determine the volume initialization parameters of
   the input volumes. Refer to the description of the DCL command
   INITIALIZE, determine a suitable cluster factor, and initialize
   the output volumes using the DCL command INITIALIZE. Then, reenter
   the command specifying the /NOINITIALIZE qualifier.


CMDCAN

command canceled

   Facility: NCP, Network Control Program

   Explanation: CTRL/C is typed in response to a prompt. This cancels
   the current command and returns you to the NCP> prompt.

   User Action: Retry the operation.

CMDERR

I/O error reading commands

   Facility: NCP, Network Control Program

   Explanation: RMS returned an error while reading commands from
   SYS$INPUT. The RMS error message describes the error condition.

   User Action: Take corrective action based on the accompanying RMS
   message.

CMDINPUT

error reading command input

   Facility: LOGIN, Login Processor

   Explanation: An error occurred while attempting to read the input
   file. An accompanying message will provide more information. The
   most common cause is a read timeout while trying to obtain the
   user name or password.

   User Action: Correct the problem described by the accompanying
   message, and try again.

CMDLIN

command line segment in error 'error'

   Facility: DIFF, DIFFERENCES Command

   Explanation: Part of the command line is syntactically incorrect.

   User Action: Specify the correct syntax in the command line.

CMDNOTFND

command not found-use RECALL/ALL to display saved commands

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The command that you tried to find using RECALL is
   not found.

   User Action: Use the RECALL/ALL to display all the saved commands
   and then modify and reenter your RECALL command.

CMDNOTVLD

command not valid on the running system

   Facility: SDA, System Dump Analyzer

   Explanation: You entered an SDA command while analyzing the
   running system. The command is valid only when analyzing a dump
   file.

   User Action: None. The command is not valid while analyzing the
   running system.

CMDOBS

MSCP server must be loaded by setting SYSBOOT parameter
MSCP_LOAD

   Facility: SYSGEN, System Generation Utility

   Explanation: The MSCP command within SYSGEN is now obsolete. The
   proper way for loading the MSCP server is to set the SYSGEN
   parameter MSCP_LOAD. This will load the MSCP server during
   SYSBOOT.

   User Action: Setting the SYSGEN parameter to load the MSCP server
   during SYSBOOT will result in a warning when the MSCP command
   within SYSGEN is entered. If this error is printed as the result
   of a startup command procedure, changing the parameter to load the
   server earlier will enable the old command procedure to complete
   successfully with only a warning message.

CMDSYNTAX

command line syntax error

   Facility: LINK, Linker Utility

   Explanation: A command syntax error is detected by the command
   interpreter.

   User Action: Reenter the command correctly.

command syntax error

   Facility: DIFF, DIFFERENCES Command

   Explanation: The syntax of the DIFFERENCES command line is
   incorrect.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary to determine the correct command syntax and reenter the
   command.


CMDTOOLONG

command line exceeds maximum length

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The length of your command, after any symbols and
   logical names have been expanded, exceeds the maximum allowable
   length.

   User Action: Reenter a shorter form of the command.

command line too long in options file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An options file line is too long.

   User Action: Shorten the line and relink.


CMODSUPR

change mode to supervisor trap, code = 'nnn', PC = 'location', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An image attempted to execute a change mode to
   supervisor instruction, but the image did not have a change mode
   handler declared. This message indicates an exception condition
   and is usually followed by a display of the condition arguments,
   registers, and stack at the time of the exception. The code
   displayed in the message is the change mode code specified in
   the instruction.

   User Action: Examine the PC and virtual address displayed in the
   message to determine which instruction caused the error.

CMODUSER

change mode to user trap, code = 'nnn', PC = 'location', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An image attempted to execute a change mode to user
   instruction, but the image did not have a change mode handler
   declared. This message indicates an exception condition and
   is usually followed by a display of the condition arguments,
   registers, and stack at the time of the exception.

   User Action: Examine the PC and virtual address displayed in the
   message to determine which instruction caused the error.

CMPOUTF11

the /COMPARE qualifer requires save set as first input

   Facility: BACKUP, Backup Utility

   Explanation: In a compare operation between a save set and a disk
   volume, you must specify the save set as the first input and the
   disk volume as the second input.

   User Action: Correct and reenter the command.

CNF

character string expected, not found: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A required character string is missing.

   User Action: Supply the missing string.

CNFOVR

internal error-Too many cluster members

   Facility: SMI, System Management Intergator/Server

   Explanation: The configuration table in SMIREMOTE has overflowed.

   User Action: Submit a Software Performance Report showing all
   SYSMAN commands leading to this error. Also, submit the output of
   the SHOW CLUSTER command.

CNFQUAVAL

conflicting qualifier values for 'qualifier', 'qualifier'

   Facility: ERF, Error Log Utility

   Explanation: Two or more conflicting qualifiers were specified.

   User Action: Use the DCL HELP command or refer to the VMS DCL
   Dictionary to determine the qualifiers in conflict and reenter the
   command.

CNS

command not supported: 'n'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The command is not supported by this version of DSR;
   in this case n is an internal DIGITAL number.

   User Action: Remove or replace the command.

CNTERR

connect error code of 'xx' on file 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: A VMS RMS $CONNECT request failed due to the error
   represented as 'xx'.

   User Action: Correct the error (represented as 'xx') and retry the
   request.

CNTRLY

Are you repeating ^Y to abort the remote session on node 'node-
name'?

   Facility: REM, Set Host Facility

   Explanation: This message provides an opportunity to terminate the
   connection if logging out is not possible on the remote node.

   User Action: Enter YES or NO.

CNVRTING

'library filespec' is a copy of 'old library filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This message is generated by the DCL command
   LIBRARY. The specified modification to a Version 1.0 library
   automatically converts it to the new library format. This message
   is informational.

   User Action: None.

CNXMGRERR

error detected by Connection Manager

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

COB

can't open binary output file 'filespec'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR cannot create the BRN file required to generate a
   table of contents from the titles and header levels.

   User Action: Check to see if you have write access to your current
   default directory. If the problem continues, notify the system
   manager.

COD

invalid or unsupported type field in XAB at 'address'

   Facility: RMS, VMS Record Management Services

   Explanation: The XAB at the indicated address contains an invalid
   type code field, or the XAB is not valid.

   User Action: The status value (STV) field of the FAB provides the
   address of the XAB in error. Verify that the call to the VMS RMS
   service is coded correctly.

COF

can't open footnote work file 'filename'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR cannot create the temporary file required to
   process the footnote information.

   User Action: Check to see if you have write access to your current
   default directory and enough quota. If the problem continues,
   notify the system manager.

COI

can't open input file 'filename'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The input file specification is erroneous, the file
   is nonexistent, or you do not have read access to the file.

   User Action: Check the file specification for errors, or check to
   see if you have read access to the file. If the problem continues,
   notify the system manager.

COLLERR

error during data collection

   Facility: MONITOR, Monitor Utility

   Explanation: An unexpected error occurred while collecting the
   requested MONITOR data. More information can be obtained by
   examining the linked message that follows this one.

   User Action: Correct the error indicated by the linked message
   and rerun the MONITOR command. If the linked message is NOPRIV, it
   may indicate that the Monitor Utility is not installed with the
   required privileges. Please report such a problem to the system
   manager.

COMBCLU

cannot combine multiple classes with the cluster class

   Facility: MONITOR, Monitor Utility

   Explanation: The CLUSTER class cannot be combined with other
   classes.

   User Action: Reenter your command with only the CLUSTER class
   listed.

COMCOD

compilation 'error' in module 'module-name' file 'library filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This warning message is generated by the DCL
   command LIBRARY. The object module you are inserting contains
   a compilation error, warning, or an illegal compilation code.

   User Action: Recompile the module before reentering the command
   line.

COMFAIL

a communication failure is detected

   Facility: DTK, DECtalk Facility

   Explanation: A communications malfunction occurred since the
   DECtalk device was turned on.

   User Action: Check the DECtalk hardware.

COMFIL

contents of component database

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The following output is being generated from the
   startup component file on the named system.

   User Action: None.

COMFILEMTY

startup component database is empty

   Facility: SMI, System Management Intergator/Server

   Explanation: The current startup component entry does not have any
   entries.

   User Action: Use the SYSMAN command STARTUP ADD FILE to add
   entries to this database before using commands to examine or
   modify entries.

COMMA

requested value is terminated by a comma

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The returned value is terminated by a comma, implying
   that additional values are in the list.

   User Action: None.

Command buffer exhausted

   Facility: EDT, EDT Editor

   Explanation: The string of change mode commands exceeds 255
   characters.

   User Action: Divide the string into several lines and reenter the
   command.

Command buffer exhausted during XLATE command processing

   Facility: EDT, EDT Editor

   Explanation: You have put too many characters in your XLATE
   procedure. EDT can handle only 255 characters per command line.

   User Action: Enter fewer characters.

Command file could not be closed

   Facility: EDT, EDT Editor

   Explanation: The startup command file cannot be closed. The
   appropriate system message provides more information on the nature
   of the problem.

   User Action: Correct the problem indicated by the accompanying
   message.

Command file could not be opened

   Facility: EDT, EDT Editor

   Explanation: The command file given in the command line cannot be
   opened. EDT will display an associated file system message for the
   error.

   User Action: Correct the problem indicated by the file system
   message.

Command file does not exist

   Facility: EDT, EDT Editor

   Explanation: The command file parameter in the command line does
   not exist in the specified directory.

   User Action: Reenter the command specifying a command file
   parameter that does exist in the specified directory.

COMMHARD

communications hardware error detected

   Facility: SYSTEM, VMS System Services

   Explanation: A hardware error has occurred on the DUP11, the local
   modem, or the line between the modem and the DUP11, while the 3271
   Protocol Emulator is active.

   On a write request, there is a UNIBUS timeout returned by the
   DEUNA hardware.

   User Action: Check the lines for obvious hardware problems, for
   example, a disconnected plug. If the error still occurs, consult a
   DIGITAL Field Service representative.

   The UNIBUS should be checked to make sure it is not overloaded and
   that all devices on the UNIBUS are working properly.

COMOREXE

filename not of type COM or EXE

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A startup component file name contains a file type
   other than COM or EXE.

   User Action: Use STARTUP MODIFY to correct the file name.

COMPARED

compared 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility has successfully completed a
   compare operation. This message is displayed only when the /LOG
   command qualifier is used.

   User Action: None.

COMPAT

compatibility mode fault (code 'nnn') at PC 'location', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An RSX-11M image attempted to execute an illegal
   instruction, indicated by one of the following codes:

   Code    Meaning

   0       Reserved instruction execution

   1       BPT instruction executed

   2       IOT instruction executed

   3       EMT instruction executed

   4       TRAP instruction executed

   5       Illegal instruction executed

   6       Odd address fault

   7       TBIT trap

   User Action: Check for a programming error and make any necessary
   corrections.

COMPBEGIN

comparing queue file 'filespec' to queue file 'filespec' beginning
at 'date-and-time'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This is an informational message that indicates the
   specified queue files are being compared.

   User Action: None.

COMPEND

comparing queue file 'filespec' to queue file 'filespec' ended at
'date-and-time'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This is an informational message that indicates the
   comparison of the specified queue files has finished.

   User Action: None.

COMPFAIL

comparison found differing values for field 'type-of-field'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: Different values for the specified field in the two
   queue files are being compared. This message is followed by a
   message that specifies the two different values for the field.

   User Action: If the specified difference is undesirable, attempt
   to make appropriate changes according to the accompanying message.

COMPILED

compilation completed without errors

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The execution of the built-in procedure COMPILE has
   been successfully completed; that is, a procedure, string, or
   buffer has been compiled without warnings or errors.

   User Action: None.

COMPILEFAIL

compilation aborted

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A syntax error exists in the program you are
   trying to compile. The compilation of the program is prematurely
   terminated.

   User Action: Correct the syntax error and recompile your program.

COMPLETE

processing complete 'string'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: The DSR Table of Contents Utility has completed
   processing the indicated input file. This message is
   informational.

   User Action: None.

COMPLX

expression too complex-simplify

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The command interpreter cannot analyze an arithmetic
   expression in a command, because it contains too many operators
   and/or parentheses.

   User Action: Shorten the expression and reenter the command. If
   necessary, execute more than one command.

COMPSYNC

queue file 'filespec' is missing 'type-of-data' 'name-of-item'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: The specified queue file is missing the specified
   item. The item is skipped over in an attempt to resynchronize
   comparison of the remaining data in the two queue files.

   User Action: Specify the item in both queue file descriptions,
   retry the upgrade, or attempt to make appropriate changes at the
   DCL level.

COMREMJBC

error communicating with another job controller

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error communicating
   with a job controller on another processor in a VAXcluster. The
   accompanying message provides additional information.

   User Action: Take action based on the accompanying message.

COMSTA

component in wrong state

   Facility: NCP, Network Control Program

   Explanation: A component is in a state inconsistent with the
   request; for example, a down-line load is attempted over a line
   with OFF status.

   User Action: Check the status of the component and reenter your
   command.

CONABORT

connection to node 'node-name' aborted by CTRL/C

   Facility: MAIL, Mail Utility

   Explanation: The user typed CTRL/C while MAIL is attempting to
   connect to the specified node. The transmission of the message is
   aborted.

   User Action: None.

CONCAT

requested value is terminated by a plus sign

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The returned value is concatenated to the next value
   with a plus sign, implying that additional values are in the list.

   User Action: None.

CONCEALED

logical device name concealed physical device name

   Facility: SYSTEM, VMS System Services

   Explanation: This alternate success status indicates that the
   system service completed successfully, and the device name that is
   supplied as input to the service translated to a concealed device.

   User Action: None.

CONERR

connect error

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.

CONFATTR

conflicting attributes in definition

   Facility: CDU, Command Definition Utility

   Explanation: The CLD file has conflicting attributes. Attributes
   are mutually exclusive (for example, a CLD file can name both an
   image and a routine).

   User Action: Remove one of the mutually exclusive attributes from
   the CLD file.

CONFBASADR

conflicting base address for image 'image-name' base of 'address' in
file 'filename' conflicts with base of 'address' in file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A shareable image contained in two other based
   shareable images, both of which were included in the link, is
   found to be at two separate virtual addresses.

   User Action: Either (1) correct one or both of the based shareable
   images giving the shareable image in question the same base
   address in both images, or (2) make both based shareable images
   position independent.

CONFCON

CONCATENATE has already been specified

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a NOCONCATENATE clause after
   processing a CONCATENATE clause in the same value definition.
   NOCONCATENATE and CONCATENATE clauses cannot be specified in the
   same value definition.

   User Action: Edit the CLD file so that each value definition does
   not contain both CONCATENATE and NOCONCATENATE clauses.

CONFDEFREQ

only one DEFAULT or REQUIRED clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one DEFAULT or REQUIRED
   clause in a single value definition. Only one DEFAULT or REQUIRED
   clause is allowed per value definition.

   User Action: Edit the CLD file so that each value definition does
   not contain more than one DEFAULT or REQUIRED clause.

CONFDEL

'filename', delete? (Y or N):

   Facility: Shared by several facilities

   Explanation: This message requests interactive confirmation before
   deleting the indicated file.

   User Action: Type Y if you want the file deleted, and type N if
   you do not want it deleted.

CONFDIS

a DISALLOW clause has been specified

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a NODISALLOWS clause after a
   DISALLOW clause is processed in a single verb/syntax definition.
   NODISALLOWS cannot be specified in a verb/syntax definition in
   which DISALLOWS is previously specified.

   User Action: Edit the CLD file so that each verb/syntax definition
   does not contain both DISALLOW and NODISALLOWS clauses.

CONFFAC

facility definition conflicts with previous definition

   Facility: MESSAGE, Message Utility

   Explanation: The same facility name or facility number is
   specified for two different facilities.

   User Action: Reenter the facility definitions so that each
   facility name corresponds to one facility number.

CONFIXMEM

conflicting virtual memory requirement for fixup section for image
'image-name' Restructure image or eliminate based shareable images

   Facility: LINK, Linker Utility

   Explanation: The linker is unable to allocate virtual memory for
   the fixup section because a based shareable image is taking up the
   space.

   User Action: Restructure the set of shareable images to be
   nonbased, or leave enough space between them for the object
   modules.

CONFLICT

illegal combination of command elements-check documentation

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Two or more qualifiers, keywords, or parameters that
   cannot be used in combination were used in the same command line.

   User Action: Remove the offending element.

the /PASSWORD and /GENERATE_PASSWORD qualifiers are mutually exclusive

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The /PASSWORD qualifier and the /GENERATE_PASSWORD
   qualifier are mutually exclusive.

   User Action: Reenter the command with one qualifier.


CONFMEM

conflicting virtual memory requirement at 'address' for 'decimal-
number' pages in cluster 'cluster-name'

   Facility: LINK, Linker Utility

   Explanation: Virtual memory required for a cluster has already
   been allocated.

   User Action: Correct and relink.

CONFNEG

NEGATABLE has already been specified

   Facility: CDU, Command Definition Utility

   Explanation: CDU has encountered a NONNEGATABLE clause after
   processing a NEGATABLE clause in the same keyword definition.
   A NEGATABLE clause and a NONNEGATABLE clause cannot be specified
   in the same keyword definition.

   User Action: Edit the CLD file so that each keyword definition
   does not contain both NEGATABLE and NONNEGATABLE clauses.

CONFNOCON

NOCONCATENATE has already been specified

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a CONCATENATE clause after processing
   a NOCONCATENATE clause in the same value definition. CONCATENATE
   and NOCONCATENATE clauses cannot be specified in the same value
   definition.

   User Action: Edit the CLD file so that each value definition does
   not contain both CONCATENATE and NOCONCATENATE clauses.

CONFNODIS

NODISALLOWS has already been specified

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a DISALLOW clause after a NODISALLOWS
   clause is encountered in a single verb/syntax definition.
   DISALLOW cannot be specified in a verb/syntax definition in which
   NODISALLOWS is previously specified.

   User Action: Edit the CLD file so that each verb/syntax definition
   does not contain both NODISALLOWS and DISALLOW clauses.

CONFNONNEG

NONNEGATABLE has already been specified

   Facility: CDU, Command Definition Utility

   Explanation: CDU has encountered a NEGATABLE clause after a
   NONNEGATABLE clause is processed in the same keyword definition. A
   NONNEGATABLE clause and the NEGATABLE clause cannot be specified
   in the same keyword definition.

   User Action: Edit the CLD file so that each keyword definition
   does not contain both NEGATABLE and NONNEGATABLE clauses.

CONFNOPARM

NOPARAMETERS has already been specified

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a PARAMETER clause after a
   NOPARAMETERS clause is encountered in a single verb/syntax
   definition. A PARAMETER clause cannot be specified in the same
   verb/syntax definition as NOPARAMETERS.

   User Action: Edit the CLD file so that each verb/syntax definition
   does not contain both NOPARAMETERS and PARAMETER clauses.

CONFNOQUAL

NOQUALIFIERS has already been specified

   Facility: CDU, Command Definition Utility

   Explanation: CDU has encountered a QUALIFIER clause after
   a NOQUALIFIERS clause is processed in the same verb/syntax
   definition. A QUALIFIER clause cannot be specified in the same
   verb/syntax definition as the NOQUALIFIERS clause.

   User Action: Edit the CLD file so that each verb/syntax definition
   does not contain both NOQUALIFIERS and QUALIFIER clauses.

CONFOUTPUTS

only one OUTPUTS clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one OUTPUTS clause in a
   single verb/syntax definition. Only one OUTPUTS clause is allowed
   per verb/syntax definition.

   User Action: Edit the CLD file so that each verb/syntax definition
   does not contain more than one OUTPUTS clause.

CONFPARM

a parameter has already been defined

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a NOPARAMETERS clause after a
   PARAMETER clause is processed in a single verb/syntax definition.
   A NOPARAMETERS clause cannot be specified in a verb/syntax
   definition in which PARAMETER is previously specified.

   User Action: Edit the CLD file so that each verb/syntax definition
   does not contain both PARAMETER and NOPARAMETERS clauses.

CONFQUAL

a qualifier has already been defined

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a NOQUALIFIERS clause after
   a QUALIFIER clause is encountered in a single verb/syntax
   definition. A NOQUALIFIERS clause cannot be specified in a verb
   /syntax definition in which the QUALIFIER clause is previously
   specified.

   User Action: Edit the CLD file so that each verb/syntax definition
   does not contain both QUALIFIER and NOQUALIFIERS clauses.

conflicting qualifiers

   Facility: CONVERT, Convert Utility

   Explanation: You have specified qualifiers that are mutually
   exclusive. For example, the /MERGE and the /APPEND qualifiers
   cannot be specified at the same time since they operate with files
   of different organization.

   User Action: Change the qualifiers and try again.

conflicting qualifiers

   Facility: Shared by several facilities

   Explanation: Two or more conflicting qualifiers were specified.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary to determine the qualifiers in conflict and reenter the
   command.

conflicting qualifiers, request aborted

   Facility: SYSGEN, System Generation Utility

   Explanation: The SYSGEN command AUTOCONFIGURE is entered
   specifying both the /EXCLUDE and /SELECT qualifiers.

   User Action: Reenter the command with only one qualifier.




CONFROUTIMG

only one routine or image clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one IMAGE or ROUTINE clause
   in a single verb/syntax definition. IMAGE and ROUTINE clauses are
   mutually exclusive.

   User Action: Edit the CLD file so that each verb/syntax does not
   contain more than one IMAGE or ROUTINE clause.

CONNEC

unable to connect to listener

   Facility: NCP, Network Control Program

   Explanation: NCP is unable to connect to NML to perform network
   operations. Information accompanying this message explains
   any secondary reasons for this error. Your network may not be
   configured correctly, your access control information may be
   invalid, or all files may not be present.

   User Action: If you receive this message upon entering the SET
   EXECUTOR NODE command, then you should try the command again after
   correcting the problem or after supplying valid access control
   information. You may then resume entering NCP commands. Inspect
   the log file created by NML on the destination node to see if it
   provides additional information as to the cause of the problem.

CONNECFAIL

connect to network object timed-out or failed

   Facility: SYSTEM, VMS System Services

   Explanation: The remote node did not respond to the logical-link
   request.

   User Action: Check to see if the node is reachable and retry.

CONSEQERR

a control sequence malfunction is detected

   Facility: DTK, DECtalk Facility

   Explanation: A DECtalk private control sequence malfunction
   occurred since the DECtalk device was turned on.

   User Action: Check the DECtalk hardware.

Consistency check failed, please check your file

   Facility: EDT, EDT Editor

   Explanation: There is a discrepancy between the number of lines
   and characters present when the editing session ends. This message
   indicates an EDT problem.

   User Action: Check for possible errors in your output file. Submit
   a Software Performance Report (SPR).

CONSTRTOOLARGE

constant string too large

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A constant declaration includes a constant expression
   that exceeds the internal tables of the compiler.

   User Action: Use an expression that generates a shorter string.

CONTINUE

unable to continue processing 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The specified file, which is being processed at
   a change of save set volumes, is no longer accessible. The
   accompanying message provides additional information and the
   Backup Utility terminates processing of the file. If other file
   activity is occurring on the volume, the error is probably caused
   because another user deleted the file during the back-up process.

   User Action: Note that the file is incompletely processed.

CONTINUED

'save set spec' contains a continued file-cannot append

   Facility: BACKUP, Backup Utility

   Explanation: In a save operation with the /NOREWIND qualifier, the
   specified volume contained a multivolume file that is continued
   on another volume, and therefore a file cannot be appended to the
   volume.

   User Action: Retry the operation using the /REWIND qualifier
   to force BACKUP to initialize the output volume, or use another
   volume.

CONTRACT

contract virtual address space error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

CONTRADEF

contradictory definition for variable or constant 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The variable or constant definition contradicts its
   previous definition.

   User Action: Rename the variable or constant to a unique name, or
   change the definition to match its previous definition.

CONTROLC

operation aborted by CTRL/C

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The program stopped executing because you pressed
   CTRL/C.

   User Action: None. However, if you have kept a journal file, you
   can exit from VAXTPU and restart the session.

operation completed under CTRL/C

   Facility: SYSTEM, VMS System Services

   Explanation: An operation did not finish because CTRL/C is
   pressed. This message indicates success.

   User Action: None.

operation completed under CTRL/C

   Facility: RMS, VMS Record Management Services

   Explanation: An operation did not finish because CTRL/C is
   pressed. The operating system does not normally display this
   message.

   User Action: None.



CONTROLO

output completed under CTRL/O

   Facility: SYSTEM, VMS System Services

   Explanation: An output operation to the terminal did not finish
   because CTRL/O is pressed. The operating system does not normally
   display this message.

   User Action: None.

operation completed under CTRL/O

   Facility: RMS, VMS Record Management Services

   Explanation: An operation did not finish because CTRL/O is
   pressed. The operating system does not normally display this
   message.

   User Action: None.


CONTROLY

operation completed under CTRL/Y

   Facility: SYSTEM, VMS System Services and RMS, VMS Record
   Management Services

   Explanation: An operation did not finish because CTRL/Y is
   pressed. The operating system does not normally display this
   message.

   User Action: None.

CONVERT_STALL

destination log file too small - conversion aborted

   Facility: LMCP, Log Manager Control Program

   Explanation: An attempt was made to convert an existing log file
   to a destination log file that is too small. During the conversion
   the log manager stalled, indicating an inadequate destination log
   file size.

   User Action: To continue with the operation, specify a larger
   destination log file size in the command line.

COO

can't open output file 'filename'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The output file specification is erroneous, or you do
   not have write access to the file.

   User Action: Check the file specification for errors, or check
   to see if you have write access to the file. If the problem
   continues, notify the system manager.

COPIED

copied 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility successfully completed a save
   operation. This message is displayed only if the /LOG qualifier is
   specified.

   User Action: None.

COPIEDB

input-filespec copied to output-filespec ('nnn' blocks)

   Facility: Shared by several facilities

   Explanation: The message displays the number of blocks or the
   number of blocks copied, based on the size of the input files.
   This message is informational.

   User Action: None.

COPIEDC

'input-filespec' copied to 'output-filespec' ('nnn' records packed
into 'mmm' blocks)

   Facility: Shared by several facilities

   Explanation: The message displays the number of records read in
   from the input file and the number of blocks written to the output
   file. This message is informational.

   User Action: None.

COPIEDR

input-filespec copied to output-filespec ('nnn' records)

   Facility: Shared by several facilities

   Explanation: The message displays the number of records or the
   number of records copied, based on the size of the input files.
   This message is informational.

   User Action: None.

COPMSG

user record copied

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is informational.

   User Action: None.

COPY_LOG

copy of log from 'log-filename' follows:

   Facility: UETP, User Environment Test Package

   Explanation: The current process has been created and is
   communicating with other processes in the UETP. To centralize
   the reporting of information about the progress of the UETP, this
   process is copying the log file from the execution of one of those
   processes.

   User Action: None.

COPY_LOG_ENDED

end of log file from 'filespec'

   Facility: UETP, User Environment Test Package

   Explanation: The current process has finished copying the log file
   introduced by the UETP$_COPY_LOG message.

   User Action: None.

COPY_LOG_LINE

'text'

   Facility: UETP, User Environment Test Package

   Explanation: The current process is copying a line of the file
   introduced by the UETP$_COPY_LOG message. Normally, only the text
   being copied appears; the facility, severity, and IDENT fields are
   not printed.

   User Action: None.

COR

can't open required file 'filename'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The required file specification is erroneous, or the
   file is nonexistent, or you do not have read access to the file.

   User Action: Check the file specification for errors, or check to
   see if you have read access to the file. If the problem continues,
   notify the system manager.

CORRUPTEMB

EMB packet header has been corrupted

   Facility: BUGCHECK, System Bugcheck

   Explanation: The system has detected corruption of the system
   error log buffers. The system allocates space for error log
   entries from a set of common buffers. System software that makes
   use of the error logging routines typically writes into these
   entries. This message occurs when an attempt to write into an
   error log entry has overwritten other parts of the system error
   log buffers. The most common cause of this error is a coding error
   within a device driver.

   User Action: Submit a Software Performance Report (SPR) that
   includes a BACKUP save set of the system dump file generated by
   this error. (Use the /IGNORE=NOBACKUP qualifier on the BACKUP
   command that produces the save set included with your SPR.)

Could not align tabs with cursor

   Facility: EDT, EDT Editor

   Explanation: The cursor is in a position where it cannot be evenly
   divisible by the tab size when the tab compute function is used.

   User Action: Change the tab size or cursor position.

CPU ucode not at required rev level for port activity

   Facility: VAXport, VAXport Driver

   Explanation: The port driver will not attempt to start the port.

   User Action: On an 11/750, make sure that the console TU58 is
   present and up-to-date. Otherwise, call DIGITAL field service to
   check the port hardware.

CPUCEASED

CPU ceased execution

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

CPUEXIT

shutdown requested by another CPU

   Facility: SMP, Symmetric Multiprocessing

   Explanation: The current processor was requested to perform a
   bugcheck by another processor in the multiprocessor system.

   User Action: This bugcheck occurs as a direct result of a request
   by another processor only. Analyze the crash dump to determine
   which CPU is the 'crash CPU' and the reason why that CPU crashed.

CPUNOTACT

requested CPU not active

   Facility: SYSTEM, VMS System Services

   Explanation: The current process requires system functionality
   that is not available or no longer available among the active
   processors in the system. If this message is associated with a
   vector disabled (VECDIS) status code, a vector-present processor
   within the system has failed or has been removed from the system.

   User Action: Notify your system manager.

CPUNOTVLD

CPU not booted or CPU ID out of range

   Facility: SDA, System Dump Analyzer

   Explanation: You specified an invalid CPU ID for the SDA command
   SET CPU or SHOW CPU. The CPU ID is invalid either because there is
   no CPU in the system with the specified CPU ID, or because the CPU
   with the specified CPU ID was never booted and was not active at
   the time of the system failure.

   User Action: Reenter the command with a valid CPU ID.

CPUSANITY

CPU sanity timer expired

   Facility: SMP, Symmetric Multiprocessing

   Explanation: One of the processors in a multiprocessor
   configuration detected that another processor that is
   participating in the SMP environment is no longer responding to
   hardware clock interrupts.

   User Action: After the system reboots, determine which processor
   stopped responding to hardware clock interrupts by analyzing the
   crash dump generated by this bugcheck. Further analysis of the
   crash dump might show the reason why that CPU was not responding
   to clock interrupts, for example, it was looping in a driver at an
   IPL high enough to block its clock interrupts. Correct the code
   that stayed at high IPL for too long.

CPUSPINWAIT

CPU spinwait timer expired

   Facility: SMP, Symmetric Multiprocessing

   Explanation: One of the processors in a multiprocessor
   configuration held onto a spin lock longer than the permissible
   period of time. This is detected by another processor, which is
   trying to acquire that spin lock during that time.

   User Action: Analysis of the crash dump will show the spin lock
   that was held too long and should show the reason that the owning
   CPU did not release the spin lock when it should. For example,
   if the owning CPU had acquired the spin lock multiple times and
   subsequently released the spin lock using the conditional release
   option of the spin lock unlock macro when it should have executed
   a 'total' release of that spin lock, then the owning CPU will
   proceed with execution while it is unaware that it still owns the
   spin lock. Meanwhile, another CPU that attempts to acquire that
   spin lock will eventually time out and generate this bugcheck.

CPUSTARTD

CPU 'number' started

   Facility: SYSTEM, VMS System Services

   Explanation: The START/CPU command was used to start CPU 'number'.
   This message indicates that the boot sequence for the selected CPU
   has been started. The CPU may not actually start, if for example,
   CPU self test fails.

   User Action: None. This message is informational..

CPUSTARTIP

CPU 'number' startup in progress, cannot stop

   Facility: SYSTEM, VMS System Services

   Explanation: The STOP/CPU command was used to stop CPU 'number'
   but the selected CPU is currently starting and cannot be stopped
   until the startup is complete.

   User Action: Wait until the CPU has started and then re-issue the
   STOP/CPU command.

CPUSTOPPING

CPU 'number' stopping

   Facility: SYSTEM, VMS System Services

   Explanation: The STOP/CPU command was used to stop CPU 'number'.
   This message indicates that the selected CPU is in the process
   of stopping. In some situations, the CPU will not actually stop.
   Because some multiprocessor systems support primary CPU switching,
   a STOP/CPU command can stop the current primary, and cause a new
   primary CPU to be selected. However, if the selected CPU cannot
   become primary, (the console may have disabled it from becoming
   primary), the primary switch will not occur, and the primary CPU
   will not be stopped.

   User Action: None. This message is informational.

CRC

network DAP level CRC check failed

   Facility: RMS, VMS Record Management Services

   Explanation: CRC checksums computed by VMS RMS and the File Access
   Listener (FAL) at the remote node did not match when compared
   during a VMS RMS close operation. The file that is created or
   modified may be corrupted.

   User Action: Repeat the file access. If the CRC error on close
   persists, the communication hardware is malfunctioning.

CRCLS

the 'class-name' class cannot be removed from this report

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The class name entered does not apply to the
   currently selected report and therefore cannot be removed from the
   Report (SPR). The name is, however, valid in a different Report
   (SPR).

   User Action: Select a different report or enter the HELP CLASSES
   command to get a list of available classes.

CRE

ACP file create failed

   Facility: RMS, VMS Record Management Services

   Explanation: A file could not be created. This message is
   associated with a system status code returned from a file system
   ACP QIO request made by VMS RMS.

   User Action: The status value (STV) field of the FAB contains
   a code that provides more information about the condition. Take
   corrective action based on this status code.

CREA_ERR

error creating work file 'filespec'

   Facility: CONVERT, Convert Utility

   Explanation: This message will be accompanied by an RMS error
   message that explains the error.

   User Action: Correct the error described in the RMS error message
   and try again.

CREATDIR

creating temporary directory "dir-name".

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL creates a temporary directory if you
   specify the Get Save Set option. This message is informational.

   User Action: None.

CREATE

error creating 'filename'

   Facility: FDL, Create/FDL Utility and FDL, Edit/FDL Utility

   Explanation: This message will be accompanied by a VMS RMS error
   message that explains the error.

   User Action: Correct the error described in the VMS RMS error
   message and try again to create an output file.

CREATED

file is created, not opened

   Facility: Shared by several facilities

   Explanation: A system service, VMS RMS, or file system ACP request
   to create a file or directory (if it does not currently exist)
   completed successfully with a new file or directory.

   User Action: None. The applications program should detect and
   respond, if necessary, to this condition.

'filename' created

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: Indicates that an output file has been created.

   User Action: None.

'filename' created

   Facility: RMS, VMS Record Management Services

   Explanation: File is created when the CREATE_IF option is
   specified. This message indicates success.

   User Action: None.

'filespec' created

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The file was successfully created.

   User Action: None.

'filespec' created

   Facility: Shared by several facilities

   Explanation: This message is displayed when command activity
   results in a new file or directory. This message is informational.

   User Action: None.

file/section/resource did not exist-is created

   Facility: SYSTEM, VMS System Services

   Explanation: This file, section, or resource did not already exist
   and has just been created.

   If global sections are specified, this status is returned to
   processes that actually create a section through use of the
   $CRMPSC system service. (Omission of SEC$M_GBL results in the
   creation of local sections, rather than the creation of global
   sections and the return of this status.) This message indicates
   success.

   User Action: None.

requested item is created

   Facility: PPL, Parallel Processing Facility

   Explanation: The requested item is created. An alternate success
   status indicates that the item is not found.

   User Action: Continue normally.







CREATED_SOME

created some of those requested-partial success

   Facility: PPL, Parallel Processing Facility

   Explanation: Some, but not all, of the requested items were
   created.

   User Action: If processing can continue with fewer items than
   those requested, then continue normally.

CREATEDSTM

'filename' has been created in stream format

   Facility: Shared by several facilities

   Explanation: RMS created the file in stream format with embedded
   carriage control because format and carriage control were
   specified in the RMS $CREATE call and are not supported by the
   remote node. This message is informational.

   User Action: None.

CREATEFAIL

unable to activate subprocess

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The use of the built-in procedure CREATE_PROCESS has
   failed to successfully start a subprocess.

   User Action: Re-create the subprocess, and if unsuccessful, check
   your ASTLM, PRCLM, or BYTLM quotas.

CREATELOST

error creating directory [SYSLOST]

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to create the directory [SYSLOST] to enter lost files. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.

CREATEVIRT

error creating the virtual volume 'volume'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility received an error from RMS while
   trying to create a Files-11 file to be used as a virtual volume.

   User Action: This message will be followed by one or two error
   messages reporting the actual condition discovered by RMS. Take
   corrective action suggested by the RMS error messages, then retry
   the command.

CREDIR

created directory 'directory-name'

   Facility: BACKUP, Backup Utility

   Explanation: BACKUP successfully created the directory
   'directory'. This message is displayed only if the /LOG qualifier
   is specified.

   User Action: None.

CREDIRERR

error creating directory 'directory-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during
   an attempt to create the specified directory. The accompanying
   message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

CREERR

unable to create SYSUAF.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.

CREJOB

error opening job 'job-name' for user 'user-name' in queue 'queue-
name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error occurred during a $SNDJBC system service
   call attempting to create a job. This job and the information
   about its files are not restored during the upgrade.

   User Action: The accompanying message gives information about why
   the operation failed. Attempt to correct the problem and retry
   the upgrade, or, after the upgrade, print or submit the job as
   originally desired using the DCL command PRINT or SUBMIT.

error creating job

   Facility: PRINT, PRINT Command and SUBMIT, SUBMIT Command

   Explanation: The system encountered an error creating a batch
   or print job. The accompanying message provides additional
   information.

   User Action: Correct the error and reenter the command.


CRENEWFOLD

folder 'folder-name' does not exist. Do you want to create it (Y/N,
default is N)?

   Facility: MAIL, Mail Utility

   Explanation: You have requested MAIL to place a message into a
   nonexistent folder.

   User Action: Confirm the request by entering Y, or abort with a
   carriage return.

CREPARFIL

unable to create parameter file

   Facility: SYSGEN, System Generation Utility

   Explanation: An error occurred during a WRITE operation.

   User Action: Reenter the command so that you can write to the
   file.

CREPRC

process creation failed

   Facility: RUN, Run Detached Utility

   Explanation: The creation of the subprocess or detached process
   failed. For an explanation of possible reasons for failure, see
   the error codes returned by the CREPRC system service.

   User Action: Correct the problem described by the CREPRC error
   message, and reenter command.

CREPRCFAL

error creating process for batch job

   Facility: JBC, Job Controller

   Explanation: The job controller was unable to create a process for
   the execution of a batch job. Usually, this indicates a lack of
   system resources, such as process slots, needed to complete the
   $CREPRC system service request.

   User Action: Resubmit the batch job. If the condition persists,
   contact your system manager.

CREPRIJOB

error creating print job on queue 'queue-name'

   Facility: MAIL, Mail Utility

   Explanation: An error occurred when you attempted to create a
   print job to queue a message for printing. This message is usually
   accompanied by a system error message indicating the reason for
   the failure.

   User Action: Resolve the problem and reenter the command.

CREQUE

error creating queue 'queue-name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error occurred during a $SNDJBC system service
   call attempting to create a queue. This queue, its jobs, and
   information about its files are not restored during the upgrade.

   User Action: The accompanying message gives information about why
   the operation failed. Attempt to correct the problem and retry the
   upgrade, or after the upgrade has completed, enter the DCL command
   INITIALIZE/QUEUE as originally desired. If the queue contained
   jobs waiting for execution, the CREJOB message should also appear
   during the upgrade.

CRE_STM

file is created in stream format

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS created the file in stream format with
   embedded carriage control instead of using the record format (RFM
   field) and carriage control (RAT field) type specified in the VMS
   RMS $CREATE call. This file format conversion is performed because
   the remote DECnet system only supports stream format files. This
   message indicates success.

   User Action: None.

CRF

can't read back saved footnotes

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR has successfully written footnote information
   to the work file but cannot read it back. One or more 001RNO.TMP
   files may already exist.

   User Action: Delete any 001RNO.TMP files, and reprocess the file.
   If the problem continues, notify the system manager.

CRFERR

error encountered in Cross Reference

   Facility: LINK, Linker Utility

   Explanation: An error is returned by the Cross-Reference Facility.

   User Action: The additional message from the Cross-Reference
   Facility should explain the problem.

CRMP

CRMPSC system service failed to map global buffers

   Facility: RMS, VMS Record Management Services

   Explanation: This message is associated with a system status code
   returned from the $CRMPSC (Create and Map Section) system service
   called from VMS RMS to map global buffers.

   User Action: The status value (STV) field of the RAB contains
   a code that provides more information about the condition. Take
   corrective action based on this status code.

CRMPSC

error code of 'xx' mapping section

   Facility: PATCH, Patch Utility

   Explanation: The system service $CRMPSC request failed due to the
   error represented as xx.

   User Action: Correct the error (represented as xx) and retry.

CRP

can't recognize page on /PAGES qualifier

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A page range specification is illegally formatted.

   User Action: Correct the page range specification.

CTRL/C ignored

   Facility: EDT, EDT Editor

   Explanation: You attempted to use CTRL/C to interrupt an EDT
   operation that EDT does not allow you to abort.

   User Action: None. You cannot abort the operation.

CTRLCEXIT

exit now to avoid journal file inconsistency

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Use of CTRL/C often causes a journal file
   inconsistency during recovery.

   User Action: Exit immediately after pressing CTRL/C to save your
   edits. You can then reenter the editing session.

CTRLCHAR

the following line contains control characters-ignored

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: DSR encountered control characters in a line of the
   input file. The control characters were ignored, however.

   User Action: None.

CTRLCJOU

CTRL/C may have invalidated the journal file

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A CTRL/C character has been detected in the journal
   file. This may mean that the rest of the session is invalid.

   User Action: If you used CTRL/C during an editing session, exit
   immediately and restart VAXTPU.

CTRLERR

disk boot driver virtual circuit failure

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: The satellite could not establish a virtual circuit
   to the MSCP server on the boot node or received a hardware error
   during communications.

   User Action: Check that the MSCP server is loaded on the boot
   node, verify the CLUSTER_AUTHORIZE.DAT file, and look for hardware
   errors on the boot node's system disk and PE/Ethernet port.

fatal controller error

   Facility: SYSTEM, VMS System Services

   Explanation: The exact meaning depends on the device. This message
   may indicate a hardware error. If this message is associated with
   a status code returned by a request to a disk driver or magtape,
   it indicates a controller-related error. For example, one or more
   of the following conditions can cause this error:

   o  Late data

   o  Error confirmation

   o  Invalid map register

   o  Interface timeout

   o  Missed transfer

   o  Programming error

   o  Read timeout

   o  RX01 switch set incorrectly (RX02 only) (disk driver specific)

   If this message is associated with a status code returned by a
   request to a DR11-W interface, a fatal error that affects all
   DR11-W activity is set in the DR11-W CSR on completion of the
   QIO request. Look at the third and fourth words of the IOSB (CSR
   and EIR) for the specific cause of the error. If the condition
   indicated in the CSR can be cleared, that is, if the ATTN bit
   can be cleared, SS$_DRVERR is returned. If the condition cannot
   be cleared, SS$_CTRLERR is returned. In both cases, the driver
   performs a device reset to the DR11-W.

   If this message is associated with a status code returned by a
   request to a DR32 interface, a fatal hardware malfunction occurred
   that stops all DR32 activity. (Only for start data transfer
   functions.) The second longword of the IOSB contains additional
   information pertaining to this error; the following bit values are
   associated with SS$_CTRLERR:

      XF$V_IOS_INVPTE
      XF$V_IOS_SBIERR
      XF$V_IOS_RDSERR

   If this message is associated with a status code returned by a
   request to a DMC/DMR device, it can occur for one of the following
   reasons:

   o  NAK threshold errors exceeded

   o  Time out on response from remote end

   o  Buffer not available

   o  Maintenance message received in RUN mode

   o  Message too long to fit in receiver buffer

   o  Modem has disconnected

   o  Start message is received in run mode

   o  Nonexistent memory error

   o  Halt to DMC/DMR is complete

   If this message is displayed, restart the DMC/DMR device.

   If this message is associated with a status code returned by
   a LPA11-K driver, it is a fatal error that affects all LPA11-K
   activity. The LPA11-K terminates all active requests. The third
   and fourth words of the IOSB contain the LPA11-K Ready-Out Status
   Register and Maintenance Register contents. In particular, the
   high byte of the third word contains the specific LPA11-K error
   code.

   If this message is associated with DEUNA hardware, on a STARTUP
   request the startup failed because of bad error return from the
   DEUNA hardware. On a read request, the hardware returned a zero-
   length message.

   User Action: Action depends on the type of device to which the I/O
   request is directed. If the failure is on STARTUP, then the DEUNA
   should be checked by running UETP or DIGITAL field service should
   run the DEUNA diagnostics. If the failure is on a read request and
   the protocol has enabled PADDING, then the remote software module
   should be corrected to stop sending zero-length messages.

   If the failure persists, notify the system manager.


CTRLY

installation cancelled via CTRL/Y.

   Facility: VMSINSTAL, Install Procedures

   Explanation: You canceled the installation by entering CTRL/Y.
   This message is informational.

   User Action: None.

CTXSTSERR

Error obtaining vector context test subprocess status

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an
   error following vector context testing. This error is received
   in relation to a previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

CUR

no current record (operation not preceded by $GET/$FIND)

   Facility: RMS, VMS Record Management Services

   Explanation: A program attempted a VMS RMS $DELETE, $TRUNCATE, or
   $UPDATE operation without having performed a successful $GET or
   $FIND operation.

   User Action: Check for a programming error. Modify the source
   program, if necessary, to detect and respond to the condition.

CUREXEC

current executor node name 'node-name'

   Facility: NCP, Network Control Program

   Explanation: This message is output after an NCP SET EXECUTOR NODE
   command is entered, and the command failed, or if an established
   link to another executor failed. It indicates the name of the
   node that NML is treating as the executor. This message is
   informational.

   User Action: None.

CVTERR

could not convert entity 'time or number' using 'time or number'

   Facility: RUN, Run Detached Utility

   Explanation: Time specified with the /DELAY, /INTERVAL, or
   /SCHEDULE qualifiers is not in the proper format, or the value
   entered could not be converted to a numeric value.

   User Action: Reenter qualifier value (time or number) in the
   proper form.

error converting to decimal value, 'value'

   Facility: ERF, Error Log Utility

   Explanation: An attempt is made to convert a value to decimal
   resulting in an error.

   User Action: Submit a Software Performance Report (SPR).


CVTUNGRANT

cannot convert an ungranted lock

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt is made to convert a lock that is not
   granted. (Only locks that are granted may be converted to another
   lock mode.)

   User Action: See the section on the lock management services in
   the VMS System Services Reference Manual and correct your program.

CWF

can't write footnote file (N)

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR can open the footnote work file but cannot write
   into it; N is a system error code.

   User Action: Reprocess the file. If the problem continues, notify
   the system manager.

DAC

ACP file deaccess failed during $CLOSE

   Facility: RMS, VMS Record Management Services

   Explanation: An error occurred when a file is closed. The file is
   deaccessed. This message is associated with a status code returned
   from a file system ACP QIO request made by VMS RMS.

   User Action: The status value (STV) field of the FAB contains
   a code that provides more information about the condition. Take
   corrective action based on this status code.

DAN

invalid data area number for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The data area number specified in a key definition
   XAB is not a defined area for the file.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

DATACHECK

write check error

   Facility: SYSTEM, VMS System Services

   Explanation: The data in memory did not match the data on disk
   during a data check operation. If this message is associated with
   a status code returned by a LPA11-K driver, a mismatch between the
   microcode in memory and the microcode loaded into the LPA11-K is
   detected. The second word of the IOSB contains the number of bytes
   successfully loaded.

   Another possible explanation is that the Ethernet hardware
   detected a late collision on a write request.

   User Action: Note the condition. If necessary, modify the source
   program to detect and respond to the condition. This message
   may indicate a hardware error. Check the Ethernet cable and all
   Ethernet controllers for proper operation. If the error persists,
   notify the system manager.

DATADEVERR

data error on 'device-name' byte 'location' good data = 'xx' bad
data = 'xx'

   Facility: UETP, User Environment Test Package

   Explanation: One of the UETP tests detected a difference between
   the data that is written from memory and the same data after it is
   read back into memory. The 'location' is the offset from the start
   of the buffer where the first difference is detected.

   User Action: Investigate the device or mechanism that caused the
   error.

DATAER

data error on 'device-type' unit 'number' byte 'location' good data
= 'xx' bad data = 'xx'

   Facility: UETP, User Environment Test Package

   Explanation: One of the UETP tests detected a difference between
   the data that is written from memory and the same data after it is
   read back into memory. The 'location' is the offset from the start
   of the buffer where the first difference is seen.

   User Action: Investigate the device or mechanism that caused the
   error.

Datagram Free Queue Insert Failure

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the
   port; after 50 failed attempts, it marks the device off line. This
   error is caused by a failure to obtain access to an interlocked
   queue. Possible sources of the problem are CI hardware failures or
   memory, SBI (11/780), CMI (11/750), or BI (8200, 8300, and 8800)
   contention.

   User Action: Call DIGITAL Field Service.

Datagram Free Queue Remove Failure

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the
   port; after 50 failed attempts, it marks the device off line. This
   error is caused by a failure to obtain access to an interlocked
   queue. Possible sources of the problem are CI hardware failures or
   memory, SBI (11/780), CMI (11/750), or BI (8200, 8300, and 8800)
   contention.

   User Action: Call DIGITAL Field Service.

DATALSTSYN

data list syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The data list in the directive contained a syntax
   error. For example, the directive .LONG 3,,5 contains a data list
   syntax error because there is no data item between the two commas.

   User Action: Correct the syntax of the data list.

DATAOVERUN

data overrun

   Facility: SYSTEM, VMS System Services

   Explanation: This message can indicate the following:

   o  More data is read into the user buffer than the user buffer can
      hold.

   o  More data is written into the user buffer than the user buffer
      can hold.

   o  Card reader data is written into the controller data buffer
      before the driver is able to receive the previous data.

   If this message is associated with a status code returned by a
   request to a magnetic tape driver, the data block read is longer
   than the assigned buffer. In the case of a read reverse operation,
   the last data on the tape (that is, the data nearest the end-of-
   tape at the beginning of the operation) is the first data read.
   This data is in the buffer.

   User Action: Specify a larger buffer if the data is too much for
   the existing buffer. If the problem occurred on a card reader
   operation, resubmit the cards to the card reader. You can also
   use the DCL command SET TERMINALE/ALT to turn on the alternate
   typeahead buffer. Then increase the typeahead buffer size or the
   alternate typeahead buffer size, or both, by modifying the TTY
   SYSGEN parameters.

DATAOVFL

data area overflow in section-please submit SPR

   Facility: MESSAGE, Message Utility

   Explanation: An internal error in the compiler has been detected.

   User Action: Submit a Software Performance Report (SPR).

DATATRUNC

data truncation error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The specified value did not fit in the given data
   type. The assembler truncated the value to make it fit.

   User Action: Reduce the value or the number of characters in an
   ASCII string or change the data type.

DATFILCRE

component database created

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The specified STARTUP component database is created.

   User Action: None.

DATMISMCH

creation date of 'date' in shareable image 'image-name' differs from
date of 'date' in shareable image library 'library-name'

   Facility: LINK, Linker Utility

   Explanation: A shareable image extracted from a shareable image
   library has a different creation date from the date recorded for
   that shareable image in the library.

   User Action: Insert the new shareable image into the shareable
   image library using the DCL command LIBRARY.

DATTOOLNG

length of new data may not exceed length of old data

   Facility: PATCH, Patch Utility

   Explanation: This error is returned when patching in absolute mode
   (PATCH/ABSOLUTE), and the length of the data being inserted is
   longer than that of the data to be replaced in the file.

   User Action: Make sure that the data to be inserted is equal to or
   shorter in length than the data in the file.

DBCORRUPT

component database is corrupt

   Facility: SMI, System Management Intergator/Server

   Explanation: The startup component database is corrupt.

   User Action: Verify that the file being used is a component
   database and that the file has not been edited or otherwise
   modified. If the problem still exists, submit a Software
   Performance Report and include the component database.

DBGERR

internal debugger coding error; DEBUG base address: 'address_value'
DEBUGSHR base address: 'address_value'

   Facility: DEBUG, VMS Debugger

   Explanation: An internal debugger coding error has been
   encountered.

   User Action: If the error is reproducible, submit a Software
   Performance Report and, if possible, enclose both a copy of
   the program being debugged and a logged debugging session that
   reproduces the error.

DBGTFR

image 'image-name' has no Debugger transfer address

   Facility: LINK, Linker Utility

   Explanation: A debugger is requested with the /DEBUG qualifier,
   but the linker could not locate a transfer address within the
   debugger module.

   User Action: If you specified the optional filename parameter
   with the /DEBUG[=filename] qualifier, ensure that the specified
   debugger module contains a transfer address. If you specified
   /DEBUG, without the filename parameter, submit a Software
   Performance Report (SPR).

DBLERR

double error halt restart

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable hardware
   error. Because of the severity of the error, further operation
   is impossible; or if it is possible, it may corrupt user data.
   After all of physical memory is written to a system dump file, the
   system will automatically reboot if the BUGREBOOT system parameter
   is set to 1.

   User Action: Thoroughly test all system hardware components. If no
   hardware errors are located and if the problem persists, submit
   a Software Performance Report (SPR). The SPR should describe
   the conditions at the time of the error, and should include a
   BACKUP save set containing the system dump file and the error log
   file active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command to produce the save set.)

DCVNOTFND

domain converter not found

   Facility: CDA

   Explanation: The required domain converter could not be found.

   User Action: Only tabular to document domain conversions (for
   example, DTIF to DDIF) are currently supported. Check the formats
   specified for input and output files to ensure that a document to
   tabular conversion is not being attempted.

DDIFIN

'count' line(s), 'count' frame(s) read from file 'filename'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU opened the named DDIF file and read the
   indicated number of lines and frames from that file into a buffer.

   User Action: None.

DDIFOUT

'count' line(s), 'count' frame(s) written to file 'filename'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU wrote the indicated number of lines and frames
   from a buffer into the named DDIF file.

   User Action: None.

DEADLOCK

deadlock detected

   Facility: SYSTEM, VMS System Services, RMS, VMS Record Management
   Services

   Explanation: The system detected a set of processes waiting for
   locks in a circular fashion (deadlock). This lock request is
   denied in order to break the deadlock.

   User Action: Recovery from a deadlock is application-specific.
   One common action is for the program to release all of its
   locks (performing any necessary cleanup) and then to retry the
   operation. See the section on the lock management services in the
   VMS System Services Reference Manual and rerun the program.

DEBUG

breakpoint at line 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A BREAK statement has been executed.

   User Action: None.

command interpreter debugger signal at PC 'location', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: The DCL command DEBUG is issued after CTRL/Y
   interrupted an image that is not linked with the debugger.

   User Action: Link the image with the /DEBUG qualifier to enable
   use of the debugger.


DECNET

your DECnet network is up and running.

   Facility: VMSINSTAL, Install Procedures

   Explanation: When VMSINSTAL begins an installation, it makes sure
   that your DECnet network has been shut down. This check failed.
   VMSINSTAL asks if you want to continue the installation.

   User Action: DIGITAL recommends that you correct this situation
   before continuing.

DECOVF

arithmetic trap, decimal overflow at PC = 'xxxxxxxx', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: A decimal overflow caused an arithmetic overflow
   condition.

   User Action: Examine the PC location displayed in the message and
   check the program listing to verify that operands or variables are
   specified correctly.

decimal overflow

   Facility: LIB, Library Facility

   Explanation: During an arithmetic operation, a decimal value
   exceeds the largest representable decimal number. The result of
   the operation is set to the correctly signed least significant
   digit.

   User Action: None.


DECPTREF

decrement page table reference count error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DECTSTFAI

a local self-test has failed

   Facility: DTK, DECtalk Facility

   Explanation: A local self-test malfunction occurred since the
   DECtalk device was turned on.

   User Action: Check the DECtalk hardware.

DEFAULTED

entity defaulted present in command string

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This status is returned by the CLI$PRESENT CLI
   interface routine to indicate that the specified entity is not
   explicitly present in the command line, but is present by default.

   User Action: None.

DEFAULTLEN

a default is limited to 'max-length' characters in length, including
commas

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a DEFAULT assignment in the CLD
   file that exceeded the maximum allowable length for a DEFAULT
   assignment. Currently, the maximum length for a DEFAULT assignment
   is 94 characters.

   User Action: Edit the CLD file so that no DEFAULT assignments are
   greater than 94 characters in length.

DEFCHARSTIC

error defining characteristic: name 'characteristic-name', number
'characteristic-number'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error occurred during a $SNDJBC system service
   call attempting to define characteristics. The definition for this
   characteristic is not restored during the upgrade.

   User Action: The accompanying message gives information about why
   the operation failed. Attempt to correct the problem and retry
   the upgrade, or after the upgrade, enter the DCL command DEFINE
   /CHARACTERISTIC as originally desired.

DEFERR

unable to obtain DEFAULT record

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.

DEFFORM

error defining form: name 'form-name', number 'form-number'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error occurred during a $SNDJBC system service
   call attempting to define a form. The definition for this form was
   not restored during the upgrade.

   User Action: The accompanying message gives information about why
   the operation failed. Attempt to correct the problem and retry the
   upgrade, or after the upgrade, enter the DCL command DEFINE/FORM
   as originally desired.

DEFFORUSE

default format used, could not determine user's preference

   Facility: LIB, Library Facility

   Explanation: Translation of LIB$DT_FORMAT failed and the VMS
   standard representation is used.

   User Action: Examine and make corrections to the logical LIB$DT_
   FORMAT.

DEFKEY

'state' key 'key-name' has been defined

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified key is defined.

   User Action: None.

DEFOVF

too many command procedure parameters-limit to eight

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command procedure is invoked with more than eight
   parameters.

   User Action: Reenter the command; do not specify more than eight
   parameters.

DEFPWD

Warning: copied or renamed records must receive new password

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You did not explicitly specify a password for the new
   record.

   User Action: You must specify a password for the new record.

DEL

RFA-accessed record is deleted

   Facility: RMS, VMS Record Management Services

   Explanation: A record accessed by the record's file address (RFA)
   is deleted previously.

   User Action: Modify the program, if necessary, to detect and
   respond to the condition.

DELACCESS

file protection does not allow delete access

   Facility: JBC, Job Controller

   Explanation: The file protection of the specified file, which is
   entered with the delete option, does not allow delete access to
   the requestor.

   User Action: None.

DELCONPFN

fatal error in delete contents of PFN

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DELDATERR

error deleting data from 'library-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. An error occurred during an attempt to delete the text;
   or a VMS RMS error occurred; or there is not enough virtual memory
   available.

   User Action: Compress the old library before deleting the
   specified text.

DELETE

error deleting 'filename' file ID ('numeric-string')

   Facility: BACKUP, Backup Utility

   Explanation: An error is encountered during an attempt to delete
   the file with the specified file identification in response to the
   /DELETE qualifier. The accompanying message provides additional
   information.

   User Action: None.

file ('file-id') 'filename' error deleting file

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to delete the specified file. The accompanying message
   provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.


DELETED

'filename' deleted

   Facility: Shared by several facilities

   Explanation: The message displays the file specification of a file
   that is deleted successfully. This message is informational.

   User Action: None.

module 'module name' deleted from 'library filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This success message is generated by the DCL command
   LIBRARY. This message is informational.

   User Action: None.

previous Known File Entry has been deleted

   Facility: INSTALL, Install Utility

   Explanation: This message is displayed as the result of issuing
   a REPLACE command in INSTALL. If the REPLACE command failed to
   create a new Known File Entry for any reason, this message is
   displayed to explicitly declare that the previous Known File
   Entry has been successfully removed. This message is a warning
   explaining why even the old entry no longer exists in case REPLACE
   failed to create a new entry.

   User Action: None.



DELETEFAIL

unable to terminate subprocess

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The use of the built-in procedure DELETE to delete a
   subprocess failed to terminate the subprocess.

   User Action: None.

DELETESWL

'device-name' is write protected - file deletion pass not executed

   Facility: BACKUP, Backup Utility

   Explanation: The input device is software write locked. The BACKUP
   Utility cannot perform the file deletion pass.

   User Action: Dismount the input device, remount it writeable, and
   either delete the files by hand or reenter the BACKUP command.

DELEXIGBL

termtable section already exists

   Facility: SMG, Screen Management Facility

   Explanation: The system program which maps Termtable as a global
   section is unsuccessful. Before a new global section can be
   created, the previous global section must be deleted.

   User Action: The system must be rebooted in order to map a new
   TERMTABLE.EXE as the new global section.

DELGBLSEC

delete global section error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DELGBLWCB

delete global section window error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DELHEADER

file ('file-id') 'filename' marked for delete

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified file is
   marked for deletion, but is not deleted.

   User Action: None. The file is deleted.

DELHEADER_BUSY

deleted file header marked "busy" in index file bitmap

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: This message is issued along with the BADHEADER
   message and gives a more detailed reason why the specified file
   header is corrupt. In this case, the file header and the index
   file bitmap are inconsistent; the file header indicates that the
   file is deleted, but the index file bitmap indicates that the file
   header is busy, for example, the file is not deleted.

   User Action: None. See the BADHEADER message.

DELKEY

'state' key 'key name' has been deleted

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified key is deleted.

   User Action: None.

DELKEYERR

error deleting 'module-name' from 'library filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. The module you want to delete does not appear in the
   module name table (MNT); a VMS RMS error occurred; or there is not
   enough virtual memory available.

   User Action: List the library to find out whether the module is
   present. If so, correct the problem before reentering the command
   line.

DELSYM

'symbol table' symbol 'symbol name' has been deleted

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This informational message verifies that the symbol
   deletion requested from the DELETE/SYMBOL command has occurred.

   User Action: None.

DELTIMREQ

delta time required, absolute time supplied

   Facility: LIB, Library Facility

   Explanation: An absolute time is passed to the routine when a
   delta time is required.

   User Action: Examine each argument and change the delta time to
   absolute time.

DELTVA

error code of 'xx' deleting 'xxx' to 'xxx'

   Facility: PATCH, Patch Utility

   Explanation: The system service request $DELTVA failed due to the
   error code represented as xx.

   User Action: Correct the error (represented as xx) and retry.

DELVER

explicit version number or wildcard required

   Facility: Shared by several facilities

   Explanation: The DCL command DELETE requires a version number in
   each file specified.

   User Action: Reenter the command. Specify either the explicit
   version number for the file you want to delete or use a wildcard
   in the version field.

DELWSLEX

delete working set list entry index error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DENOSU

'testname' device 'device-type' is not supported

   Facility: UETP, User Environment Test Package

   Explanation: The device name in this message is unknown to the
   UETP and cannot be tested by UETP, for example, a user-written
   driver might not be known to the UETP.

   User Action: The UETP either supports or knows to ignore all
   devices supported by VMS. If another device, which is not a
   supported layered product, produces this message, submit a
   Software Performance Report (SPR).

DENSITY

'saveset-spec' does not support specified density - default used

   Facility: BACKUP, Backup Utility

   Explanation: The specified tape hardware does not support the
   density selected by the /DENSITY qualifier. The Backup Utility
   uses the default density.

   User Action: Use a different tape device, or specify a different
   density.

DEQSUBLCKS

tried to dequeue lock with sublocks

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DESSTROVF

destination string overflow

   Facility: LIB, Library Facility

   Explanation: The destination string is overflowed, and the
   operation did not justify return of a warning, but a fatal error.

   User Action: Increase the length of the destination string, or use
   dynamic string for destination.

Destination for MOVE or COPY not found

   Facility: EDT, EDT Editor

   Explanation: The range specification in the command does not
   exist.

   User Action: Reenter the command specifying an existing range.

DESTP

'testname' stopped testing 'controller' unit 'number' at 'time'

   Facility: UETP, User Environment Test Package

   Explanation: A device that passed the simple read/write test in
   the initial phase of the UETP could not complete its test in the
   device test phase.

   User Action: If you think that the device should be tested by
   UETP, investigate and correct the problem; otherwise, ignore the
   message.

DEUNUS

'testname' device 'device-name' is unusable, error code = 'xxxxxxxx'

   Facility: UETP, User Environment Test Package

   Explanation: The specified device failed to pass the simple read
   /write test in the initial phase of UETP. Subsequent tests with
   UETP will not attempt to test the device. Another message usually
   follows to explain why the device failed the test. Possible
   causes are that the device is down, offline, not mounted, not
   initialized, or not write-enabled.

   User Action: Either make the device usable or ignore the message.
   Consult the Software Installation Support manual.

DEV

error in device name or inappropriate device type for operation

   Facility: RMS, VMS Record Management Services

   Explanation: A device name is not specified correctly; the device
   specified is not supported by this system, or the type of device
   specified cannot perform the requested operation (for example,
   an attempt is made to create a random access file on a sequential
   device).

   User Action: If the error occurred while a command is being
   entered, verify the syntax and spelling of the device
   specification or the logical name, if a logical name is specified.
   If the error occurred while an image is being executed, check that
   the file specification is coded correctly and that the logical
   name, if any, is assigned before the image is executed.

   If the device name is correctly specified and if the device is
   valid for the requested type of operation, verify that the device
   is available on your system. Otherwise, modify the program.

DEVACTIVE

device is active

   Facility: SYSTEM, VMS System Services

   Explanation: If this message is associated with a status code
   returned by a request to a DR32 interface, the microcode cannot be
   loaded because there is an active data transfer request (only for
   the load microcode function).

   If this message is associated with a status code returned by a
   request to an LPA11-K driver, the microcode cannot be loaded or
   the microprocessor cannot be started because there is an active
   data transfer request.

   If this message is associated with a status code returned by a
   request to a DR11-W interface, the DR11-W controller is occupied
   with a request from another process. The operating system does not
   normally display this message.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

DEVALLOC

device already allocated to another user

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt to allocate a device failed because the
   device is allocated by another user or channels are assigned to
   it. Only one user at a time can access an allocated device.

   Or, on a startup request, the user attempted to start the protocol
   as a shared default user, when a shared default user already
   exists for that protocol type.

   User Action: Wait until the current owner has deallocated the
   device, or reenter the request specifying a different device of
   the same type, or specify a generic device name in the allocate
   request.

   The user must not attempt to bring up two SHARED DEFAULT users
   until the first user is stopped.

device 'device-name' already allocated to another user.

   Facility: VMSINSTAL, Install Procedures

   Explanation: In response to the prompt Where will the distribution
   volumes be mounted? you specified a device that is allocated to
   another user. You will be asked to specify another device.

   User Action: Specify a device name that is not allocated to
   another user.


DEVALRALLOC

device already allocated to this job

   Facility: SYSTEM, VMS System Services

   Explanation: This is a success status message from the Allocate
   Device system service. The process has already allocated the
   device.

   User Action: Depending on the program logic, this may not be an
   error; no action is necessary.

DEVALSPL

device already spooled

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A request to set a device spooled is made for a
   device that is already set spooled.

   User Action: None.

DEVASSIGN

device has channels assigned

   Facility: SYSTEM, VMS System Services

   Explanation: A request to deallocate a device failed because the
   device has I/O channels assigned to it; that is, it is currently
   being read or written.

   User Action: Verify the device name (or logical name, if a logical
   name is specified) and reenter the command with the correct device
   name. If any executing subprocesses are using the device, wait
   until they have terminated before attempting to deallocate the
   device.

DEVCLASS

device class of SYS$INPUT must be terminal

   Facility: FDL, Edit/FDL Utility

   Explanation: EDIT/FDL cannot interact with a file, only with a
   terminal.

   User Action: Do not invoke EDIT/FDL from a batch job. Also, if
   invoking EDIT/FDL from an interactive command file, first include
   the following line immediately before the $EDIT/FDL command in the
   command file:

   $ ASSIGN/USER 'F$LOGICAL("SYS$OUTPUT")' SYS$INPUT

DEVCMDERR

device command error

   Facility: SYSTEM, VMS System Services

   Explanation: The exact meaning depends on the device. If this
   message is associated with a status code returned by a request
   to an LPA11-K driver (only for the initialize LPA11-K, set clock,
   and start data transfer request functions), it is associated with
   the issuance of a new LPA11-K command. The third and fourth words
   of the IOSB contain the LPA11-K Ready-Out Status Register and
   Maintenance Register contents. In particular, the high byte of the
   third word contains the specific LPA11-K error code.

   User Action: Action depends on the type of device to which the I/O
   request is directed.

DEVCOUNT

number of devices must match number of volumes

   Facility: MOUNT, Mount Utility

   Explanation: The number of devices specified in the DCL command
   MOUNT to mount a disk volume set did not match the number of
   volume labels specified in the command.

   User Action: Check the command line. Verify the names of the
   devices and volume labels for the command and then reenter the
   command with a matching number of devices and volume labels.

DEVFOREIGN

device is mounted foreign

   Facility: SYSTEM, VMS System Services

   Explanation: A Files-11 operation is attempted on a device which
   is mounted foreign.

   User Action: Remount the device as Files-11. If the medium is DOS
   or RT11 format, use FLX; otherwise, write a program.

DEVICE

devices

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued when operator status is
   requested either explicitly by the REPLY/STATUS command or
   implicitly as with the REPLY/ENABLE command. It indicates that
   the operator's terminal is enabled for "DEVICE" class operations.

   User Action: None.

DEVICEFULL

device full-allocation failure

   Facility: SYSTEM, VMS System Services

   Explanation: It indicates that space cannot be allocated for a
   file because the device is full; or a request for contiguous space
   cannot be satisfied because the specified number of contiguous
   blocks is not available.

   User Action: Verify the status of the device. If it is a
   private device, purge unwanted files with the DCL command PURGE.
   Otherwise, obtain another volume to create files. If the device is
   a system device, notify the system operator or manager that the
   volume is full.

DEVICES

only one device allowed

   Facility: MOUNT, Mount Utility

   Explanation: More than one device is specified in the DCL command
   MOUNT. Only one volume can be mounted at a time for this specified
   type of MOUNT.

   User Action: Reenter the DCL command MOUNT specifying only one
   device.

DEVINACT

device inactive

   Facility: SYSTEM, VMS System Services

   Explanation: The device unit involved in the current operation
   is inactive. This message indicates that you tried to perform an
   activity that cannot be properly performed until the device unit
   is active. For example, the XE device has not been started.

   User Action: Start the controller before doing any tributary
   requests. The user should make sure that the QIO STARTUP has
   finished successfully or that the XE device has not shut down
   the unit due to a hardware failure.

DEVMNT

device 'device-name' will be 'mount-status'

   Facility: VMSINSTAL, Install Procedures

   Explanation: The device that you specified for the output of
   the Get Save Set option is initialized (if it is a disk) and
   mounted. This message appears only if the output device you
   specified is not mounted when VMSINSTAL is started. This message
   is informational.

   User Action: None.

DEVMOUNT

device is already mounted

   Facility: SYSTEM, VMS System Services

   Explanation: The device specified has a volume mounted and cannot
   be allocated, or a volume is already mounted on a device for which
   a mount request is previously issued.

   User Action: Verify the device name (or logical name, if a logical
   name is specified) and reenter the command with the correct device
   name. If the device name is correct and if the volume that is
   mounted can be dismounted, dismount the volume and reenter the
   request.

DEVNOTALLOC

device not allocated

   Facility: SYSTEM, VMS System Services

   Explanation: The device specified in a deallocate request is not
   currently allocated.

   User Action: Verify the device name (or logical name, if a logical
   name is specified) and reenter the command with the correct device
   name.

DEVNOTBLK

'device' is not a block structured device

   Facility: BAD, Bad Block Locator Utility

   Explanation: This message indicates a fatal error. You attempted
   to perform an analysis of media that is not block structured.

   User Action: Do not use the ANALYZE/BAD command with this device.

DEVNOTERM

illegal source operator device

   Facility: OPCOM, Operator Communication

   Explanation: The DCL command REPLY requested a device that is not
   a terminal be enabled as an operator terminal; for example, the
   DCL command REPLY/ENABLE is issued in a batch job.

   User Action: Reenter the command from a terminal.

DEVNOTEXIST

device 'device-name' does not exist.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The device you specified for the output of the Get
   save set option does not exist.

   User Action: Specify a valid device name.

DEVNOTFOR

'device-name' is not mounted foreign

   Facility: BAD, Bad Block Locator Utility

   Explanation: The device is not mounted foreign.

   User Action: Mount the device using the /FOREIGN qualifier and
   reinvoke the utility.

device not mounted foreign

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An operation is requested for a device that must be
   mounted foreign to perform the operation.

   User Action: If the device is not mounted, then mount it foreign;
   if the device is mounted, dismount it and remount it foreign.


DEVNOTKNWN

unable to locate datalink driver

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: You are attempting to boot a satellite using an
   unsupported ethernet adapter.

   User Action: Check for an unsupported Ethernet adapter on the
   satellite.

unable to locate disk boot driver

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: This message indicates an internal error in the NISCS
   bootstrap.

   User Action: Submit a Software Performance Report or contact the
   Telephone Support Center.

device not known: 'input'

   Facility: SYSGEN, System Generation Utility

   Explanation: The specific device is unknown when you entered the
   SYSGEN command CONFIGURE.

   User Action: See VMS Device Support Manual for the correct UNIBUS
   controller name.



DEVNOTMBX

device is not a mailbox

   Facility: SYSTEM, VMS System Services

   Explanation: An I/O channel specified in a system service request
   is not currently assigned to a mailbox. The service requires that
   the device be a mailbox.

   User Action: Check for a programming error. Verify that the
   channel number specified for the service is valid.

DEVNOTMOUNT

device is not mounted

   Facility: SYSTEM, VMS System Services

   Explanation: This message is displayed when you issue the DCL
   command DISMOUNT for a device that is not mounted or when you
   attempt an operation that requires a mounted device.

   User Action: Reenter the command with the mounted device or mount
   the device in question.

DEVNOTSPL

device not spooled

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A request to set a device not spooled is made for a
   device that is already set not spooled.

   User Action: None.

DEVNOTSUIT

the device 'device-name' is not suitable for operations

   Facility: EXCHANGE, Exchange Utility

   Explanation: An EXCHANGE command is directed at a device for which
   the requested operation could not be performed.

   User Action: Reenter the command, specifying a suitable device.

DEVOFFLINE

device is not in configuration or not available

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: For some device-specific reason, the associated
   driver is not available. If this message is associated with
   a status code returned by a request to a DMC11 interface, the
   device protocol is not started (read or write). The function is
   inconsistent with the current state of the unit (Set Mode).

   The device is not currently on line or the Ethernet protocol has
   not been specified.

   User Action: Reenable or repair the device and retry the
   operation.

   The XE device should be checked to make sure that it has been
   configured as ONLINE. The user should make sure that all
   parameters in the QIO STARTUP request are supplied, including
   NMASC_PCLI_PTY.

device is off line

   Facility: OPCOM, Operator Communication

   Explanation: This message is displayed on the operator's console
   when a device goes off line in the VMS system configuration.

   User Action: Take appropriate measures to bring the device on
   line.


DEVOFFLINX

'date and time', Device 'device-name' is off line Mount verification
in progress

   Facility: OPCOM, Operator Communication

   Explanation: The device is off line and mount verification is in
   progress. All I/O requests are stalled.

   User Action: Cancel the mount verification or bring the volume
   back on line.

DEVONLINE

device on line

   Facility: OPCOM, Operator Communication

   Explanation: This message is displayed on the operator's console
   when a device becomes on line. This message is informational.

   User Action: None.

DEVONLY

using device name only, ignoring parts of 'filespec'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility has ignored all parts of the
   file specification except the device name. This command completed
   successfully. In the future, use the device name only in this
   context.

   User Action: None.

DEVQUALS

invalid qualifier for device type

   Facility: DUMP, File Dump Utility

   Explanation: A qualifier is specified that is invalid if the
   input medium is not a disk or tape device or is mounted with the
   /FOREIGN qualifier.

   User Action: Reenter the command.

DEVRCT

unable to analyze 'device-name', due to revector caching

   Facility: BAD, Bad Block Locator Utility

   Explanation: The device controller is capable of revectoring bad
   blocks dynamically; hence, the device will always appear to be
   flawless.

   User Action: Do not analyze the media.

DEVREQERR

device request error

   Facility: SYSTEM, VMS System Services

   Explanation: The exact meaning depends on the device. If this
   message is associated with a status code returned by a request to
   a DR32 interface, a programming error or an error associated with
   the far end DR-device is indicated. The second longword of the
   I/O status block contains additional information pertaining to the
   error; the following bit values are associated with SS$_DEVREQERR:

      XF$V_IOS_DDIDIS
      XF$V_IOS_RNGERR
      XF$V_IOS_UNQERR
      XF$V_IOS_INVPKT
      XF$V_IOS_FREQMT
      XF$V_IOS_INVDDI
      XF$V_IOS_LENERR
      XF$V_IOS_DDIERR

   If this message is associated with a status code returned by a
   request to an LPA11-K driver, it indicates an LPA11-K user request
   error for a start data transfer request. The third and fourth
   words of the IOSB contain the LPA11-K Ready-Out Status Register
   and Maintenance Register contents. In particular, the high byte of
   the third word contains the specific LPA11-K error code.

   On a write request, the DEUNA failed to transmit the message after
   16 attempts.

   User Action: Action depends on the type of device to which the I/O
   request is directed.

   The Ethernet cable may have short-circuited, or it may have been
   temporarily overloaded. In either case, the Ethernet cable should
   be checked and if it is operational, the user may wish to send
   packets again. However, it must be noted that if these kinds of
   errors persist, the Ethernet is overloaded.

DEVSELREQ

device selection required

   Facility: ERF, Error Log Utility

   Explanation: A device type or class must be selected.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary to determine the appropriate qualifier for selecting a
   device type or class. Then reenter the command.

DEVSPEC

input specification for non-file-structured dump must contain only
device

   Facility: DUMP, File Dump Utility

   Explanation: The input file specification can contain only the
   device component if the input medium is not a disk or tape device
   or if it is mounted with the /FOREIGN qualifier.

   User Action: Correct and reenter the command.

DEVWRTLCK

'date and time', Device 'device-name' has been write locked. Mount
verification in progress

   Facility: OPCOM, Operator Communication

   Explanation: A write request to a Files-11 disk has failed because
   the device is not mounted write-locked.

   User Action: Cancel the mount verification, or remove the write
   lock on the volume.

DFL

data bucket fill size larger than bucket size for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The data bucket fill size specified in a key
   definition XAB exceeds the bucket size for the data area.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

DGQINCOMP

datagram queue operation incomplete

   Facility: SYSTEM, VMS System Services

   Explanation: A request to remove a certain number of datagrams
   from a queue succeeded only partially because there were fewer
   entries available than requested. This warning message should not
   appear.

   User Action: None.

DIAGNOSTIC

job controller read record limit exceeded

   Facility: JBC, Job Controller

   Explanation: The job controller keeps count of the number of
   read operations required to process a request. If the number
   exceeds a maximum value, the job controller considers this to
   be a looping condition and proceeds to abort and restart itself.
   This message is displayed on the operator's terminal. The event is
   usually caused by a corrupted queue file, though it may indicate
   an internal job controller error.

   User Action: Enter a STOP/QUEUE/MANAGER command to close the queue
   file. If you have a cluster, do this on all nodes. Next, enter
   a START/QUEUE/ MANAGER command on one node. This will open the
   queue file and cause the job controller to perform a "cold start
   validation" of the file. If the queue file fails the test, create
   a new queue file before enabling Batch/Print facilities on the
   system.

DIAGPACK

disk is a diagnostic pack

   Facility: INIT, INITIALIZE Command,BACKUP, Backup Utility

   Explanation: Either the DCL command INITIALIZE is entered to
   initialize a volume that is identified as a diagnostic volume, or
   a Backup Utility operation is attempted using a volume identified
   as a diagnostic volume. In either case, the volume cannot be used.

   User Action: Retry the operation using another volume.

DIALFAI

autodial failed

   Facility: REM, Set Host Facility

   Explanation: The autodialer failed to dial the specified number.

   User Action: Verify the specified number and re-enter the command.

DIALINNOT

diagonal line not allowed

   Facility: SMG, Screen Management Facility

   Explanation: The vertices specified will result in a diagonal,
   rather than vertical or horizontal, line.

   User Action: Specify the vertices so that the line drawn will be
   vertical or horizontal.

DIFACCTS

values are 'account-name' and 'account-name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This message follows the COMPFAIL message and
   specifies the values (for the 'account-name' field of the job)
   in each of the two queue files being compared.

   User Action: If the specified difference is undesirable, make
   appropriate changes.

DIFCHARS

values are 'number', 'number', 'number', 'number' and 'number',
'number', 'number', 'number'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This message follows the COMPFAIL message and
   specifies octaword values for the 'characteristics' field of the
   queue or job in each of the two queue files being compared.

   User Action: If the specified difference is undesirable, make
   appropriate changes.

DIFLWDS

values are 'longword' and 'longword'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This message specifies the longword values for the
   field identified by the 'type-of-field' in the COMPFAIL message
   that precedes this message.

   User Action: If the specified difference is undesirable, make
   appropriate changes.

DIFSTRINGS

values are 'character-string' and 'character-string'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This message specifies the different character string
   values for the field identified by 'type-of-field' in the COMPFAIL
   message that precedes this text.

   User Action: If the specified difference is undesirable, make
   appropriate changes.

DIFTIMES

times are 'date-and-time' and 'date-and-time'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This message follows the COMPFAIL message and
   specifies the different values for the 'after-time' field of the
   job in each of the two queue files being compared.

   User Action: If the specified difference is undesirable, make
   appropriate changes.

DIFTYP

expected 'library-type' 'library-spec.' to be 'library-type'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This warning message is generated by the DCL command
   LIBRARY. The referenced library is actually of a different type
   from that indicated in the command string. Processing continues
   based on the actual library type.

   User Action: None.

DIFVAL

memory contains different value than specified

   Facility: PATCH, Patch Utility

   Explanation: The value specified is not contained within the given
   memory location.

   User Action: Correct the value and retry the operation.

DIGITAL Standard Runoff Version V3.0: 'number' diagnostic messages reported

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This is a standard error message line that specifies
   the actual number of error messages output.

   User Action: For more information refer to the specific error
   messages accompanying this message.

DIGITAL Standard Runoff Version V3.0: No errors detected

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This message indicates the successful processing of a
   file by DSR.

   User Action: None.

DIR

error in directory name

   Facility: RMS, VMS Record Management Services

   Explanation: A directory name is specified incorrectly. For
   example, a directory or subdirectory name string contained more
   than 39 characters. Or, use of a logical name resulted in more
   than one directory name in the file specification.

   User Action: Verify the syntax of either the directory name in
   the file specification or the logical name, if a logical name is
   specified.

DIRALLOC

directory allocation failure

   Facility: SYSTEM, VMS System Services

   Explanation: The file system failed to allocate space to increase
   the size of a directory file. Because directory files must be
   contiguous, this error might be caused by the disk being full.
   More likely, there is not enough contiguous space on the disk for
   the directory, so the free disk space is being fragmented.

   User Action: Reorganize the free disk space by copying it with the
   Backup Utility, or restructure your application to use a larger
   number of smaller directories.

DIRECT

invalid directory syntax-check brackets and other delimiters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The directory name in a file specification entered
   for a command contains an illegal character; or a command that
   expects a directory name string did not find square brackets
   ([ ]) or angle brackets (<>) in the specified parameter. Note
   that this error can occur if a physical device name is specified
   without a colon following it. This error can also occur with
   VMS Version 4.4 or higher if you use Version 3.7 syntax to
   specify a concealed device (for example, using DUA0: instead of
   /TRANSLATION_CONCEALED).

   User Action: Examine the directory name (or logical name, if
   a logical name is specified). Correct the directory syntax and
   reenter the command.

DIRE_ERROR

above error occurred writing directory, volume might be corrupted

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an error writing the
   directory of the volume. A more specific error message is printed
   immediately before this message.

   User Action: Since EXCHANGE might have already modified the volume
   in some way, it is possible that the directory stored on the
   volume does not match the current contents of the volume. It is
   possible to save all the files by creating a virtual volume and
   copying all files from the possibly corrupted volume. Note that
   this copy must be made before exiting EXCHANGE.

DIRENTRY

ACP failed to find same directory entry

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DIRFULL

directory is full

   Facility: SYSTEM, VMS System Services

   Explanation: An error occurred while a disk file is being created
   because the directory specified is full and cannot catalog any
   more entries. The maximum size of a directory file is 1024 blocks.

   If associated with a DECnet-VAX operation, this message indicates
   that the directory of declared network names is full.

   User Action: Delete or purge unwanted files from the directory and
   repeat the request; specify a different directory for the output
   file; or organize the directory into subdirectory levels to obtain
   more cataloging space. You can also use the BACKUP and RESTORE
   commands on the directory tree.

DIRNAME

directory file 'filespec' is not named '.DIR;1'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified file
   is marked with the DIRECTORY file characteristic, but it did not
   have a file type of DIR and a version number of 1. VMS RMS cannot
   recognize the file as a directory.

   User Action: Use the DCL command RENAME to rename the file.

DIRNOTCRE

'output file' directory file not created

   Facility: Shared by several facilities

   Explanation: A request to create a directory file over the network
   has failed. The creation of directory files over the network is
   currently unsupported.

   User Action: None.

DIRNOTEMPTY

directory file is not empty

   Facility: SYSTEM, VMS System Services

   Explanation: The directory you attempted to delete cannot be
   deleted because it contains files.

   User Action: Be certain that you want to delete the directory.
   Then, delete all the files in the directory first. If the
   directory is corrupted, use the DCL command SET FILE/NODIRECTORY
   to remove its status as a directory.

DIRSYNX

directive syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The directive contained a syntax error.

   User Action: Correct the syntax of the directive.

DISCON

error disconnecting link to listener

   Facility: NCP, Network Control Program

   Explanation: An error occurred while disconnecting the link to
   NML. Information accompanying this message explains any secondary
   reasons for this error.

   User Action: Take corrective action based on the accompanying
   information.

DISCONNECT

process is disconnected from requested interrupt vector

   Facility: SYSTEM, VMS System Services

   Explanation: A connection is already outstanding for the device,
   or the driver cannot reallocate AST control blocks quickly enough.
   The latter condition can occur because insufficient AST control
   blocks (P6 argument) were specified, not enough pool space is
   available for the requested AST control blocks, or the process
   ASTCNT quota is exhausted.

   On a write request, a loss of carrier signal is detected on the
   Ethernet cable.

   User Action: Check the Ethernet cable for proper operation. Check
   the DEUNA hardware for proper operation. Check the H400 or other
   Ethernet transceiver for proper operation.

DISKCLASS

fatal error detected by Disk Class driver (DUDRIVER)

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DISKFRAG

free space on 'device-name' is too fragmented

   Facility: BACKUP, Backup Utility

   Explanation: The number of free extents on the specified volume is
   unreasonably large. The volume cannot be used as a save set disk.

   User Action: Reinitialize the volume or select another volume and
   retry the operation.

DISKS

disks

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued when operator status is
   requested either explicitly by the REPLY/STATUS command or
   implicitly as with the REPLY/ENABLE command. It indicates that
   the operator's terminal is enabled for "DISKS" class operations.

   User Action: None.

DISMAL

all of the volumes have been dismounted

   Facility: MOUNT, Mount Utility

   Explanation: All of the volumes mounted by this invocation of
   $MOUNT or the MOUNT command have been dismounted because of errors
   that were detected after the volumes had been mounted. Messages
   explaining the nature of the error that forced the dismount
   usually precede this message.

   User Action: Take the corrective measures mandated by the error
   messages preceding DISMAL, and reenter the MOUNT request.

DISMOUNTD

volume 'volume-name' of volume-set 'volume-set-name' dismounted

   Facility: MOUNT, Mount Utility

   Explanation: The specified volume of the specified volume set
   has been dismounted because of errors encountered in processing
   the volume after it is mounted. An error with part of a volume
   set causes the entire volume set to be dismounted. This message
   appears for each member of the volume set that is dismounted due
   to the error condition. Only those volumes that were mounted by
   this invocation of the MOUNT command are listed. If the volume set
   name is not available, the string "name n/a" appears as the name
   of the volume set.

   A message describing the error that caused the volume to be
   dismounted usually precedes this message.

   User Action: Correct the error condition specified in the
   accompanying message and reenter the MOUNT command.

DISMPART

some of the volumes have been dismounted

   Facility: MOUNT, Mount Utility

   Explanation: Some, but not all, of the volumes that were mounted
   by this invocation of the Mount Utility or the MOUNT command have
   been dismounted due to errors detected after the volumes had been
   mounted. Preceding messages explain the nature of the error that
   forced the dismount. Also preceding this message is a list of the
   volumes that were dismounted.

   User Action: Take the corrective measures mandated by the error
   messages preceding DISMPART, and reenter the MOUNT request.

DISPCHARSTIC

error obtaining information about definition for characteristic:
name 'characteristic-name', number 'characteristic-number'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This message was encountered during a wildcard
   $GETQUI system service call attempt to display characteristics
   information. The information for this characteristic is not stored
   during the upgrade, hence it is lost after the upgrade.

   User Action: The accompanying message gives information about why
   the operation failed. Correct the problem and retry the upgrade.

DISPERR

error during display or summary output

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred while displaying the requested
   MONITOR data to the SYS$OUTPUT device, or while performing output
   operations to the summary file. To obtain more information,
   examine the accompanying linked message.

   User Action: Correct the error indicated by the linked message
   and rerun the MONITOR command. Usually, this message represents a
   status value returned to MONITOR from one of the Run-Time Library
   terminal-independent screen procedures.

DISPFILE

error obtaining information about file 'filespec' in job 'job-name'
for user 'user-name' in queue 'queue-name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error was encountered during a wildcard $GETQUI
   system service call attempting to display file information. The
   information for this file is not stored during the upgrade, hence
   it is lost after the upgrade.

   User Action: The accompanying message gives information as to why
   the operation failed. Correct the problem and retry the upgrade.

DISPFORM

error obtaining information about definition for form: name 'form-
name', number 'form-number'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error was encountered during a wildcard $GETQUI
   system service call attempt to display form information. The
   information for this form is not stored during the upgrade, hence
   it is lost after the upgrade.

   User Action: The accompanying message gives information about why
   the operation failed. Correct the problem and retry the upgrade.

DISPJOB

error obtaining information about job 'job-name' for user 'user-
name' in queue 'queue-name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error was encountered during a wildcard $GETQUI
   system service call attempt to display job information. The
   information for this job and its files are not stored during the
   upgrade, hence it is lost after the upgrade.

   User Action: The accompanying message gives information about why
   the operation failed. Correct the problem and retry the upgrade.

DISPLAY_SHORT

formatted message exceeds screen length in record 'nnn'

   Facility: AUDSRV, Audit Server

   Explanation: The entire text of the security alarm message could
   not be displayed because the terminal page length is not long
   enough.

   User Action: Increase the terminal page length, if possible, and
   try again.

DISPQUE

error obtaining information about definition for queue 'queue-name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error was encountered during a wildcard $GETQUI
   system service call attempt to display queue information. The
   information for this queue, its jobs and their files are not
   stored during the upgrade and are lost after the upgrade.

   User Action: The accompanying message gives information about why
   the operation failed. Correct the problem and retry the upgrade.

DISREQ

DISPLAY_ID parameter must be specified

   Facility: SMG, Screen Management Facility

   Explanation: A call to SMG$READ_VERIFY is made specifying right-
   justification, no DISPLAY_ID is specified, and the SCROLL_REVERSE
   sequence is not found for this terminal in TERMTABLE.EXE. Since
   right-justification requires a cursor positioning sequence to work
   properly, either the DISPLAY_ID parameter must be specified or the
   SCROLL_REVERSE sequence must be added to TERMTABLE.EXE.

   User Action: Add the DISPLAY_ID parameter to the SMG$READ_VERIFY
   call or add the SCROLL_REVERSE sequence to TERMTABLE.EXE.

DIVBY_ZER

division by zero

   Facility: STR, String Manipulation Facility

   Explanation: The string arithmetic routines attempted to take the
   reciprocal of a string whose numeric value is 0.

   User Action: The user should ensure that any string used as a
   divisor is not a null string or any other string whose numeric
   value is 0.

DIVBYZERO

divide by zero

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Division by zero is not permitted.

   User Action: None is required. However, you may want to check the
   program for attempts to divide by zero and correct any occurrences
   you find.

division by zero error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: An expression contained a division by zero.

   User Action: Change the values in the expression.


DIVZERO

attempt to divide by zero

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: An expression contained a division by zero.

   User Action: Correct the value and retry the operation.

DNA

invalid default file name string address

   Facility: RMS, VMS Record Management Services

   Explanation: The default file specification string address field
   in the FAB is not valid, or is in an area of memory that cannot be
   read by the caller.

   User Action: Check for a programming error. Verify that the call
   to the VMS RMS service is coded correctly.

DNF

directory not found

   Facility: RMS, VMS Record Management Services

   Explanation: The specified directory name does not exist on the
   specified device.

   User Action: The status value (STV) field of the FAB contains a
   system status code that provides additional information. Verify
   that both the device and directory are specified correctly. Create
   a directory on the device, if necessary, or specify an existing
   directory.

DNR

device not ready, not mounted, or unavailable

   Facility: RMS, VMS Record Management Services

   Explanation: An input/output operation cannot be performed because
   the physical device is not ready, the required volume has not been
   mounted, the device has been allocated to another user, or a file
   header on the volume has been corrupted.

   User Action: Make sure that the volume is physically loaded,
   the device is ready, and the DCL command MOUNT has completed
   successfully. Check that the correct controller is set on the
   drive. Then retry the command or program. If the error reoccurs,
   and the volume is a structured disk, run the Verify Utility (the
   DCL command ANALYZE/DISK_STRUCTURE) on the volume to check for
   file header corruption.

DNS

.NO SPACE illegal in this context

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A .NO SPACE command has been inserted following a
   command that issues a .BREAK.

   User Action: Remove the .NO SPACE command, or put it in the
   correct place.

Do you want to create a new file?

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The Authorize Utility is prompting you for an answer.

   User Action: Respond YES (Y) or NO (N).

DOESNTFIT

'string' will not fit at current indentation level

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: The indicated string will not fit on a line with the
   proper indentation of the index entry or subentry.

   User Action: Hyphenate the word using the .HYPHENATE and .BREAK
   flags.

DONEMSG

system authorization file modified

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This is an informational message.

   User Action: None.

DOS11_BADLABEL

volume on 'tapedrive' has label with invalid format

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility received an error trying to read
   a DOS-11 magtape label, or the label did not have a valid format.

   User Action: In the case of an input error, a second message will
   follow the BADLABEL message. Take corrective action based on the
   following message. In the case of invalid format, the tape mounted
   on the drive is not a valid DOS-11 volume. Find and mount the
   correct DOS-11 tape and retry the operation.

DOS11_BLOCKSIZE

volume on 'tape' has block larger than 512 bytes

   Facility: EXCHANGE, Exchange Utility

   Explanation: While reading a DOS-11 magtape, the Exchange Utility
   has read a block which is longer than 512 bytes.

   User Action: The file containing the long block cannot be
   processed by EXCHANGE.

DOS11_IOERROR

error during I/O on volume 'volume'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an error during
   input or output on a DOS-11 magtape volume.

   User Action: A second message describing the actual error
   condition will follow this message. Take corrective action based
   on the contents of the second message.

DOS11_POSITION

rewinding tape to recover correct positioning

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility has lost its position on a
   DOS-11 magtape, usually due to an input or output error.

   User Action: EXCHANGE will rewind the tape and move to the correct
   position. Please wait for this to complete.

DOUBLDALOC

double deallocation of swap file space

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DOUBLDEALO

double deallocation of memory block

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

DPE

device positioning error

   Facility: RMS, VMS Record Management Services

   Explanation: A magnetic tape file is not positioned properly.

   User Action: Depending on the operation, the status value
   (STV) field in the FAB or RAB contains a system status code
   that provides additional information about the condition. Take
   corrective action based on this status code. Retry the operation.
   If the error persists, it may indicate a system software or
   hardware failure. Notify your system operator or manager.

DQCLUS

device is mounted clusterwide, CLUSTER environment ignored

   Facility: SMI, System Management Intergator/Server

   Explanation: Disk quota functions are already operating in a
   cluster environment. To avoid duplicate efforts, the command is
   only executed on the first node in the cluster.

   User Action: Do not specify the /CLUSTER qualifier with the SET
   ENVIRONMENT command.

DRIVENAM

driver name is 'driver-name'

   Facility: SYSGEN, System Generation Utility

   Explanation: This message is issued with the message SYSVERDIF to
   identify the driver.

   User Action: See the SYSGEN message SYSVERDIF for user action
   information.

DRVERR

fatal drive error

   Facility: SYSTEM, VMS System Services

   Explanation: An input or output operation failed because of
   an error in a disk or magnetic tape drive. If this message is
   associated with a status code returned by a request to a DR11-W
   interface, a fatal error that affects all DR11-W activity is set
   in the DR11-W CSR on completion of the QIO request. Look at the
   third and fourth words of the IOSB (CSR and EIR) for the specific
   cause of the error. If the condition indicated in the CSR can
   be cleared, that is, if the ATTN bit can be cleared, SS$_DRVERR
   is returned. If the condition cannot be cleared, SS$_CTRLERR is
   returned. In both cases, the driver performs a device reset to the
   DR11-W.

   If this message is returned by a request to a magtape or a disk
   driver, it is a drive-related error. One or more of the following
   conditions can cause this error:

   o  Drive or driver timing error

   o  Illegal function

   o  Illegal register

   o  Operation incomplete

   o  Register modify refused

   o  Write clock failure (disk driver-specific)

   o  Nonexecutable function (magnetic tape-specific)

   o  Unrecovered reproducible error (magnetic tape-specific)

   User Action: Check the status of the device and reenter the
   command. Verify that the drive is on, loaded, and mounted
   correctly. If the failure persists, notify the system manager.

DRVRSTRT

error while issuing startup command to driver

   Facility: CNF, NI Configurator

   Explanation: An error occurred while attempting to issue the
   startup commands to the NI driver in preparation to reading the
   broadcast system ID messages.

   User Action: See the accompanying message to determine the
   appropriate action.

DSAQUOTA

error disabling quota processing

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to disable quota processing. The accompanying message
   provides additional information.

   User Action: Correct the condition that caused the error and use
   the Diskquota Utility to disable quota processing.

DSTNESDEP

DST nesting depth too deep in module 'path-name'

   Facility: DEBUG, VMS Debugger

   Explanation: Debug Symbol Table nesting is too deep in the
   specified module. This occurs if routine nesting or data record
   nesting is very deep in the application program.

   User Action: Simplify the program and run again.

DTP

invalid key data type for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The key data type specified in a key definition XAB
   is not a valid data type code. The valid key data codes are: STG
   (default), BN2, BN4, BN8, IN2, IN4, IN8, PAC, COL, DSTG, DBN2,
   DBN4, DBN8, DIN2, DIN4, DIN8, DPAC, and DCOL.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

DTRBADMAIL

unexpected mail received, type is 'mail-type'

   Facility: DTR, DECnet Test Program Protocol

   Explanation: The logical link is broken.

   User Action: Retry the operation.

DTSBADMAIL

unexpected mail received, type is 'mail-type'

   Facility: DTS, DECnet Test Program Protocol

   Explanation: The logical link is broken.

   User Action: Retry the operation.

DUALLOC

dual allocation on volume 'n'

   Facility: MOUNT, Mount Utility

   Explanation: A logical block on the relative volume identified in
   the message is allocated to more than one file.

   User Action: Use the DCL command ANALYZE/DISK_STRUCTURE with the
   /NOREPAIR qualifier (ANALZYE/DISK_STRUCTURE/NOREPAIR) on the
   volume. This command invokes the Verify Utility, which issues
   a message for each occurrence of dual file allocation. Verify
   Utility messages identify the file name, the range of logical
   block numbers that have been dually allocated, and the virtual
   block numbers that the logical blocks map to. You can examine
   the messages to determine the files involved in each case of dual
   allocation. Then, without allowing other file activity, copy all
   but one file involved in each case of dual allocation to a new
   version. After you create new versions of the applicable files,
   delete the versions containing dual allocation. In this way,
   blocks that are not actually free are marked as free blocks in
   the storage bit map. Next, rerun the Verify Utility on the volume,
   using the /REPAIR qualifier (ANALZYZE/DISK_STRUCTURE/REPAIR).
   Finally, examine each file and reconstruct from backup media those
   files that have been corrupted.

Dump aborted, page tables may be corrupted

   Facility: BUGCHECK, System Bugcheck

   Explanation: When writing a selective dump (SYSGEN parameter
   DUMPSTYLE set to 1), the VMS operating system relies heavily on
   the integrity of the various system and process page tables. This
   message indicates that the system might have detected corruption
   in these page tables, and it will abort further dumping. You might
   not be able to analyze the dump.

   User Action: Submit a Software Performance Report (SPR).

DUMPEMPTY

dump file contains no valid dump

   Facility: SDA, System Dump Analyzer

   Explanation: The SDA cannot read the contents of the system dump
   file. The system dump file may be unreadable because the data is
   bad or because the file is empty. If the SDA cannot read the dump
   file, it will not run.

   User Action: None.

DUMPERRORS

'number' errors occurred while writing the dump file

   Facility: SDA, System Dump Analyzer

   Explanation: The first block of the dump file contains information
   indicating that there were 'number' errors while writing out the
   information to the dump file.

   User Action: None. The dump file might not be useful for analysis.

DUMPINCOMPL

the dump file write was not completed

   Facility: SDA, System Dump Analyzer

   Explanation: The process of writing out the dump file was aborted.
   The dump file is not complete, and it is not useful for dump
   analysis.

   User Action: None. The dump file is not useful for analysis.

DUP

duplicate key detected (DUP not set)

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $PUT or $UPDATE operation specified a
   record that contained one or more key values that duplicated key
   values in other records stored in the file, and the key does not
   have the DUPLICATES ALLOWED attribute.

   User Action: Either reorganize the file and specify that duplicate
   keys are allowed, or modify the source program to detect and
   respond to the condition.

duplicate key encountered

   Facility: CONVERT, Convert Utility

   Explanation: More than one record in the input file has the same
   value in a key field, but duplicate keys are not allowed.

   User Action: Either allow duplicate keys or change the key values.


DUPBLKNUM

duplicate block number 'nnnnnnnn', already exists in 'xDBSF'

   Facility: BAD, Bad Block Locator Utility

   Explanation: The block number specified in the /BAD_BLOCKS list is
   already recorded in either the MDBSF or the SDBSF. The block is
   ignored, and processing continues.

   User Action: None.

DUPBUFNAME

buffer 'name' already exists

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The first argument for the built-in procedure CREATE_
   BUFFER must be a unique string. You have specified a name that
   already exists.

   User Action: Reenter the command with a different string as the
   first argument.

DUPCOMFIL

command file 'filespec' already being written

   Facility: PATCH, Patch Utility

   Explanation: You have already requested that a command procedure
   be written for this PATCH session.

   User Action: None.

DUPDEF

duplicate definition of 'name' encountered

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a DEFINE statement in which there is
   already a definition with the same name.

   User Action: Edit the CLD file so that all definitions use unique
   names.

DUPDEVSPC

duplicate device specified

   Facility: MOUNT, Mount Utility

   Explanation: The same tape device is specified more than once in a
   list of tape devices for the DCL command MOUNT.

   User Action: Reenter the MOUNT command specifying each device only
   once.

DUPDSKQUOTA

duplicate disk quota file entry

   Facility: SYSTEM, VMS System Services

   Explanation: Another quota entry for the specified UIC already
   exists.

   User Action: Check the UIC listed. Correct the UIC or select and
   reenter another UIC.

DUPFILENAME

duplicate file name

   Facility: SYSTEM, VMS System Services

   Explanation: The directory specified already contains an entry for
   the specified file name, file type, and version number.

   User Action: Delete the existing file, or correct the command
   or program to change the file name, file type, or version number
   specified for the output file.

DUPFORM

duplicate form number

   Facility: JBC, Job Controller

   Explanation: A DEFINE/FORM command specified a form number that is
   already defined. Each form must have a unique number.

   User Action: Specify the command so that each form is defined
   uniquely.

DUPGLOBAL

global symbol 'symbol-name' from file 'library-filespec' already in
library 'library-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. An attempt is made to insert an object module containing
   a global symbol that is already in the global symbol table (GST).

   User Action: Replace the module instead of inserting it; or remove
   the global symbol from the library before inserting the module.

DUPIDENT

only one IDENT statement is allowed

   Facility: CDU, Command Definition Utility

   Explanation: More than one IDENT statement is encountered in a
   single CLD file. Only one IDENT statement is allowed.

   User Action: Edit the CLD file so that there is only one IDENT
   statement.

DUPINVALID

component file already in STARTUP table

   Facility: SMI, System Management Intergator/Server

   Explanation: An attempt is made to add a startup component file to
   the component database which already contains that entry.

   User Action: Either use the STARTUP MODIFY FILE command at the
   SYSMAN> prompt to change the existing entry, or reenter the
   command with a new component file name.

DUPKEY

duplicate key in index

   Facility: LBR, Librarian Subroutine Package

   Explanation: This message is generated by the Librarian routines.
   On a call to LBR$INSERT_KEY, the specified key is found to exist
   already.

   User Action: Call LBR$REPLACE_KEY to replace the existing key.

keyword 'keyword-name' has already been defined

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a KEYWORD definition that conflicts
   with an existing KEYWORD definition with the same name. KEYWORD
   definitions in the same TYPE definition must be unique.

   User Action: Edit the CLD file so that each KEYWORD definition in
   the same TYPE definition is unique.


DUPKEYMAP

attempt to define a duplicate key map 'key-map-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are trying to create a key map with the same name
   as a key map or key-map list that already exists.

   User Action: Select another name for the new key map.

DUPKEYMAPLIST

attempt to define a duplicate key-map list 'key-map-list-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are trying to create a key-map list with the same
   name as a key map or key-map list that already exists.

   User Action: Select another name for the new key-map list.

DUPLABEL

only one LABEL clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one LABEL clause in a
   single qualifier/parameter definition. Only one LABEL clause is
   allowed per qualifier/parameter definition.

   User Action: Edit the CLD file so that each qualifier/parameter
   definition does not contain more than one LABEL clause.

DUPLNAM

duplicate name

   Facility: SYSTEM, VMS System Services

   Explanation: A process name specified in a request to create
   a process duplicates the name of an existing process executing
   with the same group number. Process names must be unique within a
   group.

   User Action: Specify an alternative process name. Check whether
   the existing process with that name should be deleted and, if so,
   use the DCL command STOP to delete it.

DUPMOD

module 'module-name' from file 'library-filespec' already in
'library-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. The module you are inserting into the library already
   exists in the module name table (MNT).

   User Action: Change the name of the module or replace the existing
   module with a new one.

DUPMODULE

module 'module-name' from file 'filename' already in 'name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: One of the modules being inserted into the library
   already exists in the library module name table.

   User Action: Change the name of the module being inserted, delete
   the module of the same name from the library, or use the LIBRARY
   /REPLACE option to replace the module.

only one MODULE statement allowed

   Facility: CDU, Command Definition Utility

   Explanation: More than one MODULE statement is encountered in a
   single CLD file. Only one MODULE statement is allowed.

   User Action: Edit the CLD file so that there is only one MODULE
   statement.


DUPMSG

message code nn already assigned as ss

   Facility: MESSAGE, Message Utility

   Explanation: You have assigned the same message code (nn) to more
   than one message symbol. The first message symbol (ss) assigned to
   the message code is shown.

   User Action: Check that you have not assigned twice the same
   message number or symbol for the same facility. Reenter the
   message definitions so a different message symbol is assigned
   to one message code.

DUP_OUTPUT

output file has already been specified

   Facility: SORT, Sort/Merge Utility

   Explanation: You passed the output file argument in the routine
   package more than once.

   User Action: Check your file arguments and verify that you
   specified the output file only once.

DUPPLACE

only one PLACEMENT clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one PLACEMENT clause in a
   single qualifier definition. Only one PLACEMENT clause is allowed
   per qualifier definition.

   User Action: Edit the CLD file so that each qualifier definition
   does not contain more than one PLACEMENT clause.

DUPPREFIX

only one PREFIX clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU has encountered more than one PREFIX clause in a
   single verb/syntax definition. Only one PREFIX clause is allowed
   per verb/syntax definition.

   User Action: Edit the CLD file so that each verb/syntax definition
   does not contain more than one PREFIX clause.

DUPPROMPT

only one PROMPT clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one PROMPT clause in a
   single parameter definition. Only one PROMPT clause is allowed per
   parameter definition.

   User Action: Edit the CLD file so that each parameter definition
   does not contain more than one PROMPT clause.

DUPQUAL

qualifier 'qualifier-name' has already been defined

   Facility: CDU, Command Definition Utility

   Explanation: CDU has encountered a previously defined qualifier
   in a single verb/syntax definition. All qualifiers defined in a
   single verb/syntax definition must be unique.

   User Action: Edit the CLD file so that all qualifiers defined in a
   single verb/syntax definition are unique.

DUPRVN

duplicate volume number already mounted

   Facility: MOUNT, Mount Utility

   Explanation: A volume of the same relative volume number and the
   same volume set name is already mounted. You are trying to mount a
   volume that belongs to a volume set with the same name as a volume
   set that is already mounted.

   User Action: Make sure that you have mounted the correct volume.
   Verify that you are defining the volume status (/SHARE, /NOSHARE,
   /GROUP, or /SYSTEM) consistently with volumes already mounted.

DUPSYM

'name' is a duplicate symbol definition

   Facility: CDU, Command Definition Utility

   Explanation: The same name is used twice. For example, this error
   could occur because the same syntax list or qualifier name appears
   twice in the CLD file.

   User Action: Modify the CLD file to correct the duplication.

duplicate symbol definition

   Facility: MESSAGE, Message Utility

   Explanation: You have assigned the same symbol to represent two
   values. This message may refer to symbols defined in a message
   definition, a facility definition, or the .LITERAL directive.

   User Action: Reenter your source statements with each symbol
   defined only once.


DUPSYNTAX

only one SYNTAX clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one SYNTAX clause in a
   single qualifier/parameter definition. Only one SYNTAX clause is
   allowed per qualifier/parameter definition.

   User Action: Edit the CLD file so that each qualifier/parameter
   definition does not contain more than one SYNTAX clause.

DUPTYPE

only one TYPE clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one TYPE clause in a
   single value definition. Only one TYPE clause is allowed per value
   definition.

   User Action: Edit the CLD file so that each value definition does
   not contain more than one TYPE clause.

DUPUNIT

MSCP Controller-duplicate unit number

   Facility: SYSTEM, VMS System Services

   Explanation: On a STARTUP request, the user cannot assign two
   channels to an XE unit before the unit is started in SHARED mode.
   The driver may have to relink the user's Channel Control Block
   (CCB) to a different UCB and this cannot be done if there are two
   CCBs that must be reset.

   User Action: The user must STARTUP the XE unit in SHARED mode
   before assigning any extra channels to the XE unit.

DUPVALUE

only one VALUE clause is allowed

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered more than one VALUE clause in a
   single qualifier/parameter definition. Only one VALUE clause is
   allowed per qualifier/parameter definition.

   User Action: Edit the CLD file so that each qualifier/parameter
   definition does not contain more than one SYNTAX clause.

DUPVOLNAM

volume label already present in set

   Facility: MOUNT, Mount Utility

   Explanation: During an attempt to add a volume to an existing
   volume set, the specified volume set is found to contain a volume
   with the label specified.

   User Action: Verify the labels on the existing volumes in the
   set. Choose a new label for the volume you are adding to the set,
   reinitialize the volume, and reenter the DCL command MOUNT/BIND.

DVI

invalid device ID value in NAM block

   Facility: RMS, VMS Record Management Services

   Explanation: The device identification field of the VMS RMS NAM
   block is not valid.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

DVN

duplicate variable name: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: An attempt has been made to use a name specification
   with a .VARIABLE command that has already been used with a
   previous .VARIABLE, .IF, .IFNOT, or .ELSE command.

   User Action: Change the name specification.

DX1

in-core indexing (.DO INDEX/.PRINT INDEX) is no longer supported

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: In-core indexing is no longer supported.

   User Action: See accompanying message.

DX2

instead, specify RUNOFF/INTERMEDIATE and .REQUIRE 'file.RNX' here.

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: In-core indexing is no longer supported. See
   accompanying message.

   User Action: Specify RUNOFF/INTERMEDIATE and .REQUIRE 'file.RNX'.

ECONOTSET

eco level 'nn' not set in 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: You specified an ECO level that is not set in that
   particular image file. This typically occurs when you enter the
   PATCH command CHECK ECO before entering the PATCH command UPDATE.

   User Action: Enter a SET ECO command to reenable the Patch Utility
   command processing. Specify the correct ECO level and retry the
   operation.

ECOSET

eco level 'nn' already set in 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: You specified an ECO level that has already been set
   in that particular image file.

   User Action: Enter a SET ECO command to reenable the Patch Utility
   command processing. Specify the correct ECO level and retry.

Editor aborted

   Facility: EDT, EDT Editor

   Explanation: EDT experienced some difficulties and had to abort
   the session.

   User Action: Use the journal file to recover your editing work.

EDITPROC

error creating or executing editor subprocess

   Facility: MAIL, Mail Utility

   Explanation: You entered the SEND/EDIT command and MAIL's attempt
   to create a subprocess failed. This message is issued with an
   accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

EDITSCLSH

edits clash 'editing-commands' 'filespecs'

   Facility: SUMSLP, SUMSLP Batch Editing Utility

   Explanation: Two or more conflicting editing commands have been
   entered, that is, more than one edit operation has been specified
   for one line of source code. The relevant editing commands and
   the file specifications of the SUMSLP command files are listed
   following the message, which is informational.

   User Action: None.

EDOUTSEQ

edits out of sequence

   Facility: SUM, Source Update Merge Utility and SUMSLP, SUMSLP
   Batch Editing Utility

   Explanation: The indicated edit command is not in ascending
   sequence within the update file. The editing operation has been
   performed correctly.

   User Action: Edit the update file to place the edit in the correct
   position.

EF_ALRFRE

event flag already free

   Facility: LIB, Library Facility

   Explanation: A call is made to LIB$FREE_EF to free an event flag
   number that is not allocated.

   User Action: Ensure that you use the correct event flag number in
   the call to LIB$FREE_EF.

EF_ALRRES

event flag already reserved

   Facility: LIB, Library Facility

   Explanation: A call is made to LIB$RESERVE_EF to receive an event
   flag number that is already allocated.

   User Action: Ensure that you use the correct event flag number in
   the call to LIB$RESERVE_EF.

EFD

.END FOOTNOTE doesn't terminate .FOOTNOTE

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The .ENDFOOTNOTE command is improperly positioned in
   the file; it does not follow associated footnote data.

   User Action: Put the .ENDFOOTNOTE command in the correct place, or
   remove it.

EF_RESSYS

event flag reserved to system

   Facility: LIB, Library Facility

   Explanation: A call is made to LIB$RESERVE_EF to reserve an
   invalid event flag number. Ranges for valid event flag numbers
   are 1 through 23 and 32 through 63.

   User Action: Retry specifying a valid event flag number.

ELD

.END LITERAL doesn't follow .LITERAL

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The .END LITERAL command is improperly positioned in
   the file; it does not follow the .LITERAL command.

   User Action: Put the .END LITERAL command in the correct place, or
   remove it.

ELEALREXI

an element of the same name already exists

   Facility: PPL, Parallel Processing Facility

   Explanation: An element by this name already exists, and its ID is
   returned.

   User Action: Continue normally if you expect the name to exist.

ELETOOLON

element too long, maximum 255 characters

   Facility: LIB, Library Facility

   Explanation: The initialization string element passed to LIB$INIT_
   DATE_TIME_CONTEXT is too long; the maximum length allowed is 255
   characters.

   User Action: Begin debugging procedures to verify and correct the
   problem.

EMPTY_CHECK

checkpoint contains no active transactions

   Facility: LMCP, Log Manager Control Program

   Explanation: There are no active transactions in the displayed
   checkpoint record.

   User Action: None

EMPTYDEF

no attributes supplied-DEFINE ignored

   Facility: CDU, Command Definition Utility

   Explanation: The CLD file does not contain any attributes.

   User Action: Add attributes to the CLD file.

EMPTYFILE

no modules found in file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object file contained no object modules.

   User Action: Ensure that the source file compiled properly and
   that the output object file is not empty.

zero-length page or swap file cannot be installed

   Facility: SYSGEN, System Generation Utility

   Explanation: You attempted to install a zero-length page or
   swapping file.

   User Action: None. You cannot install a zero-length page or
   swapping file.


EMPTYHIST

library update history is empty

   Facility: LBR, Librarian Subroutine Package

   Explanation: The library has an update history, but no update
   history records are present.

   User Action: None.

EMPTYIN

empty input file 'filename'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: The input file contained no data for processing.

   User Action: Edit the input file.

EMPTYJOB

no files specified in job request

   Facility: JBC, Job Controller

   Explanation: A batch or print job is requested that did not
   specify any files to process. This error condition occurs if
   the requesting process opened and closed a job using the SJC$_
   CREATE_JOB and SJC$_CLOSE_JOB function codes, but did not specify
   any files with the SJC$_ADD_FILE function of the $SNDJBC system
   service. This condition causes the open job to be removed from the
   system job queue file.

   User Action: None.

EMPTYKMLIST

key-map list 'key-map-list-name' does not contain any key maps

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are referring to a key-map list that has no key
   maps.

   User Action: Enter the built-in procedure SHOW (KEY_MAP_LISTS)
   on the command line to obtain the names of the key-map lists and
   their key maps.

EMPTYLIBRARY

no modules in library: 'library-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The library being compressed contains no modules.

   User Action: None.

EMPTYLST

known file entry list is empty

   Facility: INSTALL, Install Utility

   Explanation: There are no entries in the known file entry list.
   Therefore, LIST, DELETE, REMOVE, and PURGE will have no effect.

   User Action: None.

EMSKNOTABS

entry mask not absolute

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The entry mask expression is not absolute or it
   contained undefined symbols.

   User Action: Change the values in the expression.

ENAQUOTA

error enabling quota processing

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to enable quota processing. The accompanying message
   provides additional information.

   User Action: The Verify Utility will not reconstruct disk quota
   information. Try to correct the condition that caused the error
   and then reenter the Verify Utility command line.

END

control returned to node 'node-name'

   Facility: REM, Set Host Facility

   Explanation: A remote terminal session is ended. If DECNET has not
   been started on your system, then _0:: is displayed in place of
   your node-name. This is an informational message.

   User Action: None.

ENDABORT

'name' compilation aborted

   Facility: Shared by several facilities

   Explanation: Serious errors prevented the compilation of 'name'
   from being completed.

   User Action: Correct the errors and recompile the program.

ENDDIAGS

'name' completed with 'nnn' diagnostics

   Facility: Shared by several facilities

   Explanation: The compilation or assembly of 'name' is completed
   with diagnostics. Use of the object module produced may give
   invalid results.

   User Action: Correct the conditions which resulted in the
   diagnostics and recompile or reassemble the program.

ENDED

'name' ended

   Facility: Shared by several facilities

   Explanation: A program phase has been ended.

   User Action: None.

ENDEDD

'name' ended at 'system date and time'

   Facility: Shared by several facilities

   Explanation: A program phase has been ended.

   User Action: None.

ENDEDT

'name' ended at 'system time'

   Facility: Shared by several facilities

   Explanation: A program phase has been ended.

   User Action: None.

ENDNOOBJ

'name' completed with 'nnn' diagnostics-object deleted

   Facility: Shared by several facilities

   Explanation: The compilation or assembly of 'name' is completed
   with errors. No object file is produced.

   User Action: Correct the source language errors and recompile or
   reassemble.

ENDOFBUF

attempt to move past the end of buffer 'buffer-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You attempted to move past the end of the current
   buffer. VAXTPU makes offset 0 of the end-of-buffer mark the
   current editing position.

   User Action: Stop trying to move forward. You are already
   positioned at the end of the buffer.

ENDOFFILE

end of file

   Facility: SYSTEM, VMS System Services

   Explanation: You received this message because of one or more of
   the following conditions:

   o  A tape mark indicating end-of-file is encountered during an
      attempt to read a tape. For data transfer functions, the byte
      count is zero; for skip record functions, the count is the
      number of blocks skipped.

   o  An end-of-file card is encountered during an attempt to read
      from the card reader.

   o  A mailbox is empty or had an end-of-file (IO$_ENDOFFILE)
      written to it.

   o  No data is available for transfer on the DMC-11, and IO$M_NOW
      is specified.

   o  The file system ACP encountered the end of the allocated space
      for a virtual I/O operation or an attempted truncation.

   User Action: Note the condition. If necessary, modify the source
   program to detect and respond to the condition.

end of file on read to terminal or file

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Premature end-of-file encountered on read from input
   device or file.

   User Action: Submit a Software Performance Report (SPR).


ENDOFTAPE

end of tape

   Facility: SYSTEM, VMS System Services

   Explanation: The end of tape marker, indicating the physical end
   of the tape, is encountered.

   User Action: Note the condition. If the tape marker is encountered
   during an operation in the forward direction, it may be necessary
   to modify the source program to detect and respond to the
   condition.

ENDOFVOLUME

end of volume

   Facility: SYSTEM, VMS System Services

   Explanation: Two consecutive tape marks were detected during a
   skip file operation to a tape mounted non-file-structured or
   during a skip record operation. This return is also used as a
   logical end-of-tape indicator for non-ANSI tapes. If an ANSI
   standard tape is mounted foreign, this may only indicate an empty
   file within the volume and not the end of the volume. The high
   word of the first longword in the I/O status block contains the
   number of tape marks passed.

   User Action: Use a read function to read data located past the
   double tape mark. (The first read function returns end-of-file
   status; a second read function reads the data.)

ENDPRS

error code of 'xx' on command line parse end

   Facility: PATCH, Patch Utility

   Explanation: A command interpreter callback request failed due to
   the error represented as 'xx'.

   User Action: Correct the error (represented as 'xx') and retry.

ENDTOPIC

request LBR$OUTPUT_HELP terminate printing

   Facility: LBR, Librarian Subroutine Package

   Explanation: When a user-supplied output routine is called
   by LBR$OUTPUT_HELP, the output routine returns this status to
   terminate the printing of help text.

   User Action: None.

ENDWRNGMAC

.ENDM does not end macro 'macro-name' in 'library-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This warning message is generated by the DCL command
   LIBRARY. The macro name following the .ENDM statement does not
   match the name of the macro it should end.

   User Action: Reformat the macro source file.

statement ends wrong MACRO

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The .ENDM directive specified a different name from
   its corresponding .MACRO directive.

   User Action: Correct the name in the .ENDM directive to ensure
   that the .ENDM directive and .MACRO directive correspond as
   required.


ENGLUSED

English used, could not determine user's language

   Facility: LIB, Library Facility

   Explanation: Translation of the logical SYS$LANGUAGE (or any
   logicals depending on the specified language) failed, or the
   tables supporting the selected language were not chosen by your
   system manager. English is being used.

   User Action: Examine SYS$LANGUAGE. Verify that the logical name
   table for the language is built and that all logicals depending on
   SYS$LANGUAGE (for example, logicals to supply spellings of months
   and days of the week) are correct.

ENQ

ENQ system service request failed

   Facility: RMS, VMS Record Management Services

   Explanation: A $ENQ or $DEQ system service invoked by RMS failed.
   The status value (STV) field of the FAB contains a code that
   provides more information about the condition.

   User Action: Correct the condition described in the STV field.
   Take corrective action based on this system status code.

ENT

ACP enter function failed

   Facility: RMS, VMS Record Management Services

   Explanation: An attempt to enter a file specification in a
   directory failed. This message is associated with a status code
   returned from a file system ACP QIO request made by VMS RMS.

   User Action: The status value (STV) field of the FAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.

ENTERED

'filespec' entered as 'filespec'

   Facility: SET, SET Facility

   Explanation: The file has been entered successfully. This message
   is displayed when you specify the /LOG qualifier with the SET FILE
   /ENTER command.

   User Action: None.

ENTERLOST

file ('file-id') 'filename' error entering file in directory
[SYSLOST]

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to enter the specified file in directory [SYSLOST]. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.

ENTERR

error entering 'filespec' as 'filespec'

   Facility: SET, SET Facility

   Explanation: An error occurred while attempting to enter a
   synonym for a file. This message is accompanied by another message
   explaining why the synonym could not be entered.

   User Action: Respond to the accompanying message.

ENTFIL

error entering file on queue

   Facility: INPSMB, Input Symbiont

   Explanation: The system encountered an error creating a batch
   job from card reader input. The accompanying message provides
   additional information.

   User Action: Correct the error and reenter the job.

ENTIDMTCH

'string' ident of 'string' for entity 'string' in module 'module-
name' file 'file-name' does not match ident of 'string' in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The specified modules were not compiled with the same
   external files (for example, a library).

   User Action: Recompile the modules in error.

ENTIDMTCHB

'string' ident of number 'number' for entity 'string' in module
'module-name' file 'file-name' does not match ident of number
'number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The specified modules were not compiled with the same
   external files (for example, a library).

   User Action: Recompile the modules in error.

ENTIDMTCHO

object type of 'string' for entity 'string' in module 'module-name'
file 'filename' does not match object type of 'string' in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: You specified different object types.

   User Action: Recompile using the same object types.

ENTIDMTCHT

ident type for entity 'string' in module 'module-name' file 'file-
name' differs from ident type in module 'module-name' file 'file-
name'

   Facility: LINK, Linker Utility

   Explanation: You specified both a binary and string ident for a
   single entity.

   User Action: Recompile, specifying either a binary or string
   ident, but not both the same entity.

Entity must be WORD, SENTENCE, PAGE, or PARAGRAPH

   Facility: EDT, EDT Editor

   Explanation: The EDT command SET ENTITY is entered without one
   of the following four entity options: WORD, SENTENCE, PAGE,
   PARAGRAPH.

   User Action: Reenter the command specifying one of the four entity
   options displayed in the message text.

ENTNF

specified entity not found in command tables

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The parameter, qualifier, or keyword specified
   as input to one of the CLI$xxxx routines does not exist in the
   command tables.

   User Action: Check the spelling of the entity and its existence in
   the command tables.

ENV

current Command Environment

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The current environment is changed with the SET
   ENVIRONMENT command.

   User Action: Verify that the listed environment is correct.

support for RMS service call or feature not present

   Facility: RMS, VMS Record Management Services

   Explanation: An image attempted a VMS RMS function that is not
   supported in this version of VMS RMS.

   User Action: Consult the system manager to find out which
   functions are supported or to include your desired function.


ENVNOTSET

environment not changed

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: An error occurred in processing a SET ENVIRONMENT
   command. The previous environment is still in effect.

   User Action: Take action according to the specific error message
   accompanying this message.

EOF

end of file detected

   Facility: RMS, VMS Record Management Services

   Explanation: An end-of-file condition occurred on a VMS RMS
   service.

   User Action: If necessary, modify the source program to detect and
   respond to the condition.

end of input

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont input
   routine indicating the end of input.

   User Action: None.

end-of-file

   Facility: SMG, Screen Management Facility

   Explanation: End of file condition is detected on input.

   User Action: If necessary, modify your program to recognize this
   condition and respond to it.



EOFMISMATCH

end of file position mismatch for 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: During a compare or verify operation, the end-of-file
   pointer for the specified file did not agree with the input file.
   If other file activity is occurring on the volume, the error may
   be caused because another user modified the file during the backup
   operation.

   User Action: Note that the copies are inconsistent.

EOMERROR

compilation errors in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an internal error in the
   operating system, submit a Software Performance Report (SPR).

EOMFATAL

fatal compilation errors in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

EOMFTL

link abort specified in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module specified link abort.

   User Action: Correct the source for the module, recompile, and
   relink.

EOMSTK

'number' items left on Linker internal stack in module 'module-name'
file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module did not leave the linker stack
   empty.

   User Action: Submit a Software Performance Report on the
   appropriate language compiler.

EOMWARN

compilation warnings in module 'module'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errrors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

EOTIN

EOT response to text

   Facility: SYSTEM, VMS System Services

   Explanation: The IBM system has sent an EOT instead of an expected
   acknowledgment to XKDRIVER after receiving a block of data from
   XKDRIVER.

   User Action: Either a normal condition exists where the IBM host
   has acknowledged the receipt of a block of text with an EOT
   instead of an ACK (in this case, you do not need to provide
   corrective action), or an error has occurred. When an error
   occurs, you may need to correct and retransmit the last block
   of data to the IBM host.

EQV_NOTICE

equivalent name-device 'controller name' will be output as
'controller-name'

   Facility: SYSGEN, System Generation Utility

   Explanation: An equivalent name for a controller is entered with
   the SYSGEN command CONFIGURE.

   User Action: None. This is informational.

ERACTED

error activating editor 'editor-name'

   Facility: MAIL, Mail Utility

   Explanation: MAIL could not activate the editor specified by your
   last SET EDITOR command.

   User Action: Check the validity of your editor specification by
   using the SHOW EDITOR command. Check with your system manager to
   make sure the specified editor is available on your system.

ERASEBLKS

blocks reclaimed on relative volume N not completely erased

   Facility: MOUNT, Mount Utility

   Explanation: While rebuilding a volume set, some of the blocks
   being reclaimed could not be erased.

   User Action: The accompanying message provides additional
   information.

ERASEFAIL

volume not completely erased

   Facility: INIT, INITIALIZE Command

   Explanation: INIT encountered at least one error when it attempted
   to erase the volume.

   User Action: The accompanying message provides additional
   information.

ERBOXPROC

'process-name' Error count = 'nnn'

   Facility: UETP, User Environment Test Package

   Explanation: This message assigns a sequence number, 'nnn', to an
   error found by a particular process. The error is described in a
   subsequent message. In order to set off the error from other text
   being printed, a box of asterisks surrounds this message.

   ***********************
   *  'program name'     *
   *  Error count = 'nn' *
   ***********************

   User Action: Take action indicated by the messages that follow.

ERRASSIGN

the attempt to acquire an I/O channel for the debugger failed

   Facility: DEBUG, VMS Debugger

   Explanation: A bad status is returned from a $ASSIGN type of call.
   This message is issued in the $DBG_INFO context. The debugger
   needs to acquire I/O channels to perform I/O operations. In this
   case, the debugger failed to acquire such a channel.

   User Action: Check your process quotas.

ERRAT_LIN

error in line 'line-number' at or near 'line-number'

   Facility: SMG, Screen Management Facility

   Explanation: This is a general information message included
   with many termtable compiler messages. This message attempts to
   identify specifically where an error occurred.

   User Action: Check the specified line in your definition.

ERRCACHFUL

error cache is full

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) describing
   the conditions leading to the error. In the SPR, include a
   listing of the BACKUP save set containing the system dump file
   and the error log file active at the time of the error. (Use the
   /IGNORE=NOBACKUP qualifier with the BACKUP command that produces
   the save set included with the SPR.)

ERRCLSFILE

unable to close file

   Facility: DEBUG, VMS Debugger

   Explanation: A bad status is from a call to close a file. This
   message is issued in the $DBG_INFO context. The debugger failed to
   close a file.

   User Action: Identify the opened file with the DCL command SHOW
   DEVICE/FILES, then close the file with the DCL command CLOSE.
   Unless the reason for this message is apparent, submit a Software
   Performance Report (SPR).

ERRCRELNM

unable to create a logical name

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger creates logical names for input and
   output redirection. This message is issued in the $DBG_INFO
   context.

   User Action: Submit a Software Performance Report (SPR).

ERRCVTFIL

error returning input filename from DCL

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during processing of a MONITOR
   CONVERT command. The input file specification could not be
   obtained. Examine the accompanying message for more information.

   User Action: Correct the input file specification and reenter your
   command.

ERRCVTOPN

error opening input file for conversion

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during processing of a MONITOR
   CONVERT command. The specified input file could not be opened.

   User Action: This error may occur if the specified input file is
   incorrect or inaccessible. Correct the input file specification
   and reenter your command.

ERRDEASSIGN

attempt to deassign an I/O channel acquired by the debugger failed

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger tried to deassign an I/O channel that is
   required for internal purposes. This error notes the failure of
   the SYS$DASSGN system service, probably due to an invalid channel.

   User Action: Submit a Software Performance Report (SPR).

ERREXECOM

EXECUTE subcommand is not allowed in execute command file

   Facility: MONITOR, Monitor Utility

   Explanation: A MONITOR EXECUTE command is encountered in a MONITOR
   command file. Any Monitor Utility command may appear in a MONITOR
   command file except the EXECUTE command.

   User Action: Remove the EXECUTE command from the command file, and
   reenter the original request.

ERREXEFIL

error returning execute command filename from DCL

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during processing of a MONITOR
   EXECUTE command. The MONITOR command file specification could not
   be obtained. More information may be obtained by examining the
   accompanying message.

   User Action: Correct the error indicated by the accompanying
   message and rerun the MONITOR EXECUTE command.

ERREXEOPN

error opening execute command file

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during processing of a MONITOR
   EXECUTE command. The MONITOR command file could not be opened.

   User Action: This error can occur if the command file
   specification is incorrect, or if the file is inaccessible.
   Correct the file specification and then reenter the MONITOR
   EXECUTE command.

ERREXEREA

error reading execute command file

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred while reading a MONITOR command
   file.

   User Action: Reenter the MONITOR EXECUTE command. If the error
   reoccurs, check the command file.

ERREXEREP

error replacing "@" with "EXECUTE"

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during processing of a MONITOR
   command file. An attempt to translate the string "@" to "EXECUTE"
   failed. More information may be obtained by examining the
   accompanying message.

   User Action: Correct the error indicated by the accompanying
   message and reexecute the command file. Most such messages
   represent status values returned to MONITOR from the Run-Time
   Library string manipulation procedures.

ERRFAO

unable to format output string

   Facility: DEBUG, VMS Debugger

   Explanation: An error is returned from a call to $FAO.

   User Action: Submit a Software Performance Report (SPR).

ERRFREDYN

error freeing dynamic string when returned to LIB$FREE_VM

   Facility: STR, String Manipulation Facility

   Explanation: Unable to free space allocated to the string; this
   usually occurs when a dynamic string descriptor points to static
   storage.

   User Action: Begin debugging procedures to verify and correct the
   problem.

ERRGETDVI

unable to get device information

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger requires some information from the
   $GETDVI routine, and the call failed.

   User Action: Submit a Software Performance Report (SPR).

ERRGETEF

attempt to allocate an event flag failed

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger tried to allocate a local event flag for
   its own use, but the routine that is called to allocate the event
   flag failed. This message is usually issued with the $DBG_INFO
   routine.

   User Action: The debugger needs event flags to operate. Check the
   program being debugged for excessive allocation of event flags.

ERRHALT

halt with error interrupt pending

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ERRINPFIL

error processing /INPUT file

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred while referencing the input
   recording file. To obtain more information, examine the
   accompanying linked messages.

   User Action: Correct the error indicated by the linked messages
   and rerun the MONITOR command.

ERRINVEDIT

error invoking editor

   Facility: DEBUG, VMS Debugger

   Explanation: While the system tried to invoke an editor, an
   invalid status is returned.

   User Action: Find out if the requested editor is available. If so,
   submit a Software Performance Report (SPR).

ERRLIN

error in line 'line-number'

   Facility: SMG, Screen Management Facility

   Explanation: This is a general informational message included
   with many Termtable compiler messages. This message attempts to
   identify specifically which line contained an error.

   User Action: Check the specified line in your definition.

ERROR

error reading parameter file

   Facility: SYSGEN, System Generation Utility

   Explanation: An irrecoverable I/O error occurred while SYSGEN was
   reading a parameter file.

   User Action: Reenter the command.

Error in command

   Facility: EDT, EDT Editor

   Explanation: The command entered is invalid

   User Action: Enter a valid command.

Error in command option

   Facility: EDT, EDT Editor

   Explanation: The command entered included a /NAME qualifier where
   name is not a valid option.

   User Action: Reenter the command without specifying /NAME as a
   qualifier.

Error in range specification

   Facility: EDT, EDT Editor

   Explanation: The command requires a complete range specification.

   User Action: Reenter the command including a complete range
   specification.

internal debugger error detected

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Correct the problem given by the messages following
   this message. If you cannot solve the problem, submit a Software
   Performance Report (SPR).

unable to initialize disk boot driver

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: This is a catchall error in the bootstrap.

   User Action: Check for communication and hardware failures.

Error writing to output file

   Facility: EDT, EDT Editor

   Explanation: EDT cannot produce an output file. The problem
   file could be the MAIN buffer copy, the journal file, or a file
   requested with the WRITE command.

   User Action: After determining why EDT cannot produce an output
   file, correct the problem.


Error opening terminal for input

   Facility: EDT, EDT Editor

   Explanation: EDT could not access the specified terminal for
   input. This message appears when you are using EDT from a running
   program.

   User Action: After determining why EDT cannot access the specified
   terminal, correct the problem.

Error opening terminal for output

   Facility: EDT, EDT Editor

   Explanation: EDT could not access the specified terminal for
   output. This message appears when you are using EDT from a running
   program.

   User Action: After determining why EDT cannot access the specified
   terminal, correct the problem.

Error reading from input file

   Facility: EDT, EDT Editor

   Explanation: EDT cannot read an input file when it started the
   editing session. The problem file could be the main input file,
   the journal file if you are using the /RECOVER specifier, or the
   startup command file if you are using one.

   User Action: Determine why the input file cannot be read.

Error reading from terminal

   Facility: EDT, EDT Editor

   Explanation: EDT cannot process the input it is receiving from
   the terminal. The message appears when you are using EDT from a
   running program.

   User Action: After determining why EDT cannot process input from
   the specified terminal, correct the problem.

Error reporting suppressed, memory dump continuing

   Facility: BUGCHECK, System Bugcheck

   Explanation: This message indicates that too many errors occurred
   while writing a dump to the disk; it is no longer appropriate to
   continue to send messages for each error, and error reporting is
   suppressed. The system continues to attempt to write the dump.

   User Action: When the system reboots, copy the dump to another
   file. You can determine the text associated with the hexadecimal
   statuses of previous messages by using the F$MESSAGE lexical
   function or its equivalent. If the status indicates a possible
   disk problem, see the user action for the accompanying message.

Error writing 'nn' block(s), starting at vbn 'vv' - status = 'ss'

   Facility: BUGCHECK, System Bugcheck

   Explanation: An error occurred while writing a dump to the disk.
   The status is the error returned by the QIO$ system service that
   attempted the write operation. The system continues to attempt to
   write the dump.

   User Action: When the VMS operating system reboots, copy the dump
   to another file. You can determine the text associated with the
   hexadecimal status by using the F$MESSAGE lexical function or its
   equivalent. If the status indicates a possible disk problem, see
   the user action for the accompanying message.


ERROR_HALT

failed to load MSCP server

   Facility: STACONFIG, Stand-alone Configure Process

   Explanation: The call to load the MSCP server from STACONFIG_MSCP
   failed. Most likely there is not enough nonpaged memory available
   to allocate the server data structures and local buffer area.

   User Action: Check the values in the sysgen parameter NPAGDYN to
   ensure the amount of nonpaged memory allocated to the system is
   reasonable. Also check MSCP_BUFFER to make sure that value is not
   too large compared to the value in NPAGDYN.

ERRORISUE

completed with errors

   Facility: LINK, Linker Utility

   Explanation: The link completed, but errors were detected.

   User Action: Correct the errors and relink.

ERRORS

compilation errors in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module contains compilation errors.

   User Action: Correct the source code, then recompile or
   reassemble.

ERROUTOPN

error opening conversion file for output

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during processing of a MONITOR
   CONVERT command. The specified output file could not be opened.

   User Action: This error may occur if the output file specification
   is incorrect. Correct the output file specification and reenter
   your command.

ERRPARSE

error parsing command

   Facility: MONITOR, Monitor Utility

   Explanation: An error is detected while parsing a Monitor Utility
   command. More information may be obtained by examining the
   accompanying message.

   User Action: Correct the error indicated by the accompanying
   message and reenter the command. To obtain the correct syntax
   for utility commands, enter the HELP command in response to the
   MONITOR> prompt.

ERRPHOTRA

phonemic transcription error is detected

   Facility: DTK, DECtalk Facility

   Explanation: A phonemic transcription malfunction occurred after
   DECtalk device was turned on.

   User Action: Check the DECtalk hardware.

ERRPROMPT

error prompting for input

   Facility: MONITOR, Monitor Utility

   Explanation: An error is detected while prompting the terminal
   for input. More information may be obtained by examining the
   accompanying message.

   User Action: Correct the error indicated by the accompanying
   message and reenter the command.

ERRQIOW

error from $QIOW

   Facility: DEBUG, VMS Debugger

   Explanation: A bad status is returned from a call to $QIOW.

   User Action: Submit a Software Performance Report (SPR).

ERRRECFIL

error processing /RECORD file

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred while referencing the output
   recording file. To obtain more information, examine the
   accompanying linked messages.

   User Action: Correct the error indicated by the linked messages
   and rerun the MONITOR command.

ERRROUCAL

error in the routine call

   Facility: LIB, Library Facility

   Explanation: One or more errors were detected during a call to
   LIB$DELETE_FILE or LIB$RENAME_FILE, but a user-specified error
   routine is called to handle the conditions. This is an alternate
   success status.

   User Action: None.

ERRSMG

error returned from a call to the Screen Management Facility (SMG)

   Facility: DEBUG, VMS Debugger

   Explanation: An invalid status is returned from a call to the
   Screen Management Facility. This message may or may not be invoked
   by the debugger.

   User Action: Check the application program for potential
   interactions between it and the debugger, such as pasteboard
   sharing. Also, check the setup of the terminal, which might cause
   a problem for the Screen Management Facility. If you still do not
   know why the error occurred, submit a Software Performance Report
   (SPR).

ERRSYMACTIVE

special error symbol already active

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The special error symbol can only be set once, and it
   has already been set.

   User Action: Be sure you are the first to set the special error
   symbol.

ERRSYSINFO

failed to collect system information on node 'node-name'

   Facility: MONITOR, Monitor Utility

   Explanation: The Monitor Utility encountered a problem when it
   attempted to collect system-specific information from the remote
   node. This is generally a network problem.

   User Action: Check to make sure that DECNET is up and running on
   the remote node. Reenter the MONITOR request.

ERRSYSSERV

error returned from an internal debugger system service call

   Facility: DEBUG, VMS Debugger

   Explanation: A bad status is returned from a call to a system
   service. This message is displayed in the context of the $DBG_INFO
   macro, which lists the particular system service.

   User Action: Submit a Software Performance Report (SPR).

ERRTSTMOD

error obtaining test mode name

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization.

   User Action: Submit a Software Performance Report.

ESA

invalid expanded string address

   Facility: RMS, VMS Record Management Services

   Explanation: The expanded string area address in the VMS RMS NAM
   block is invalid; or the address is in an area of memory that
   cannot be read or written by the caller, as required; or the
   expanded string buffer contains an invalid file specification.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. Check the logical name translation.

ESCAPE

escape sequence detected

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont format
   routine indicating an escape sequence has been detected.

   User Action: None.

ESL

invalid expanded string length

   Facility: RMS, VMS Record Management Services

   Explanation: The expanded string length field in the VMS RMS NAM
   block contains a value of zero; the attempted operation requires
   the expanded string.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

ESS

expanded string area too small

   Facility: RMS, VMS Record Management Services

   Explanation: The user buffer provided to receive an expanded file
   specification string is too short; the string does not fit.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

ESTABCON

establishing connection to remote nodes . . .

   Facility: MONITOR, Monitor Utility

   Explanation: Connections to one or more remote nodes are being
   made. Connections to remote nodes are made when the /NODE
   qualifier is used or when the CLUSTER class is requested. All
   connections to remote nodes are made before data collection is
   initiated.

   User Action: None.

EVENT_OCCURRED

event XL occurred with param

   Facility: PPL, Parallel Processing Facility

   Explanation: This code indicates the occurrence of an event for
   which notification has been requested by the user.

   User Action: Since the application requested this notification,
   response is application-dependent.

EVL

too many variables: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The maximum of 20 variables has been exceeded with
   the inclusion of the specified .VARIABLE or conditional command
   (.IF, .IFNOT, .ENDIF, or .ELSE); the command in error has been
   ignored.

   User Action: Reduce the number of variables.

EVTSIZ

an event is too large to translate to DNA form

   Facility: EVL, Event Logger

   Explanation: A raw event is too large to format properly into
   DECnet standard form. Therefore, it is discarded. This is probably
   caused by a network software problem.

   User Action: Submit a Software Performance Report (SPR).

EXARANGE

invalid range of addresses

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: The range of addresses specified is in the wrong
   order. The higher address preceded the lower address.

   User Action: Retry using the following format:

   lower-boundary-address:upper-boundary-address

invalid range of addresses

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: The range of addresses specified is in the wrong
   order. The higher address preceded the lower address.

   User Action: Retry using the following format:

   lower-boundary-address:upper-boundary-address


EXASTLM

exceeded AST quota

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: An image could not continue executing or a command
   could not execute because the process exceeded its AST quota.

   User Action: If your program fails consistently because of
   insufficient quotas, contact your system manager and request that
   your quotas be increased.

EXBIOLM

exceeded buffered I/O quota

   Facility: SYSTEM, VMS System Services

   Explanation: An image could not continue to create a subprocess
   because the process exceeded its buffered I/O quota.

   User Action: If a program fails consistently because of
   insufficient quotas, contact your system manager and request that
   your quotas be increased.

EXBYTLM

exceeded byte count quota

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: The requested operation failed because the process's
   byte count quota is not large enough.

   This can occur if excessive concurrent buffered I/O is
   outstanding, if a large number of mailboxes is created, or if
   a large number of windows needs to be created to completely map a
   file.

   Failure on window creation can occur on a $CRMPSC system service
   call, the DCL command RUN, or an Access or Create of a file. In
   this case, this message indicates that the specified file is very
   fragmented or the process's byte limit quota should be increased.

   Failure can also occur on a disk read or write operation
   indicating that a prior extend operation on the file has caused it
   to become very fragmented.

   User Action: Compress the file by copying the volume with BACKUP,
   or ask the system manager to increase the BYTELIM quota.

EXCDURCAL

error occurred while executing routine called from exception break

   Facility: DEBUG, VMS Debugger

   Explanation: While executing a routine called from an exception
   break using the CALL command, an exception occurred. Any
   exceptions from routines called from an exception break cause this
   message to be displayed, followed by the text of the exception.
   Execution of the called routine is then terminated.

   User Action: Either correct the CALL command if it is in error, or
   correct the routine that caused the exception. To use the debugger
   to help find the cause of the exception, try calling the routine
   while it is not at an exception break.

EXCPSC

more than 65535 psects defined in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module defines more than 65535 psects.

   User Action: Reduce the number of psects in the module and relink.

EXCPTSTER

error testing VAX Vector Exceptions

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error while testing a vector processor's ability to
   generate exceptions.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

EXCPUTIM

CPU time limit expired

   Facility: SYSTEM, VMS System Services

   Explanation: The user's CPU time limit has expired.

   User Action: Request that a larger CPU time quota be assigned from
   the system manager and retry the operation.

EXDEPTH

exceeded allowed depth

   Facility: SYSTEM, VMS System Services

   Explanation: Either a programming error has occurred or the
   resource name tree does not have enough depth. The lock management
   services allow a certain depth to the resource name tree that is
   a function of the interrupt stack size. If the resource name tree
   requires more levels, the size of the interrupt stack must be
   increased.

   User Action: Either correct the programming error or increase the
   size of the interrupt stack by increasing the SYSGEN parameter
   INTSTKPAGES.

EXDIOLM

exceeded direct I/O quota

   Facility: SYSTEM, VMS System Services

   Explanation: An image could not continue executing or a command
   could not execute because the process exceeded its direct I/O
   quota.

   User Action: If a program fails consistently because of
   insufficient quotas, contact your system manager and request that
   your quotas be increased.

EXDISKQUOTA

disk quota exceeded

   Facility: SYSTEM, VMS System Services

   Explanation: The disk quota has been exceeded while attempting to
   create or extend a file.

   User Action: Reduce disk usage by deleting files or have the
   system manager increase the quota.

EXEABO

executor characteristics not defined

   Facility: NCP, Network Control Program

   Explanation: There is no executor node defined on the local node
   from which the NCP command COPY is entered.

   User Action: None. This error will not affect the operation of the
   COPY command.

EXECUTEFAIL

execution aborted

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Your program is terminated prematurely because of an
   error.

   User Action: Correct the error in your program and reexecute it.

EXECUTING

job executing on queue prevents requested operation

   Facility: JBC, Job Controller

   Explanation: The parameters of the specified job cannot be
   modified because the job is currently executing. Or, the specified
   queue cannot be deleted because there is a job executing from the
   queue.

   User Action: Reenter the request after the job has completed
   execution.

EXENQLM

exceeded enqueue quota

   Facility: SYSTEM, VMS System Services and RMS, VMS Record
   Management Services

   Explanation: You exceeded your ENQLM quota. Since
   the ENQUEUE quota is shared by a process and all its
   subprocesses, any of these processes could have used
   the entire quota. Also, the higher the SYSGEN parameter
   RMS_DFMBFSUR, the higher the UAF parameter ENQLM must be.

   User Action: Either increase the ENQLM quota for your account, log
   out and then log in again, and retry the operation; or modify the
   program to release locks (RMS record locks or other uses of the
   $ENQ system service), which may no longer be required.

EXFILLM

exceeded open file quota

   Facility: SYSTEM, VMS System Services

   Explanation: An image could not continue executing or a command
   could not execute because the process exceeded its open file
   quota. Since the FILLM quota is shared by a process and all
   its subprocesses, any one of these processes could have used the
   entire quota.

   User Action: If a program fails consistently because of
   insufficient quotas, contact your system manager and request that
   your quotas be increased.

EXGBLPAGFIL

exceeded global page file limit

   Facility: SYSTEM, VMS System Services

   Explanation: The attempt to allocate a global section with page
   file backing store failed because the systemwide limit on these
   pages is exceeded. No part of the section is allocated.

   User Action: Delete some similar sections or ask the system
   manager to increase the SYSGEN parameter GBLPAGFIL. Then, try
   the operation again.

EXHFUL

file extension header has no room

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

EXHNEVCAL

process exit handler was not called

   Facility: PPL, Parallel Processing Facility

   Explanation: An application stopped without executing its PPL$
   exit handler.

   User Action: The application may require an application-specific
   recovery procedure.

EXISTS

'filespec' already exists

   Facility: Shared by several facilities

   Explanation: The directory specified in the DCL command CREATE/DIR
   already exists. This message is informational.

   User Action: None.

known file entry for a version of this file already exists

   Facility: INSTALL, Install Utility

   Explanation: A known file entry already exists for this file name
   on the specified device and directory.

   User Action: Contact your system manager.


EXITFAIL

attempt to EXIT is unsuccessful

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An error occurred during execution of the built-in
   procedure EXIT; the procedure did not complete successfully. This
   usually occurs because the EXIT procedure could not write the
   modified buffers. This message should be accompanied by a message
   specifying the reason why the EXIT procedure failed.

   User Action: Take corrective action according to the reason for
   the EXIT failure; for example, if there is insufficient disk space
   to create the modified version of the output file, purge some
   files to free space on the disk.

EXITING

editor exiting

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Your program exited from the VAXTPU image.

   User Action: None.

EXITSTATUS

is 'AS'

   Facility: PPL, Parallel Processing Facility

   Explanation: An application participant exited with this status
   code.

   User Action: Determine the cause of the termination by examining
   the status code.

is 'status_value'

   Facility: DEBUG, VMS Debugger

   Explanation: The program has exited with the status 'status_
   value'. See the VMS System Services Reference Manual for more
   information about the VMS exit status codes.

   User Action: None.


EXLNMQUOTA

exceeded the job logical name table

   Facility: LOGIN, Login Processor

   Explanation: The job logical name table is full. You cannot make
   further job logical name assignments.

   User Action: Deassign logical names you no longer need to free
   space in the table.

   If you have sufficient privilege to modify the user authorization
   file, you can increase the size of the logical name table with the
   AUTHORIZE command MODIFY. The format of the command is:

   AUTHORIZE MODIFY username/JTQUOTA=n

   The variable n is the size of the job logical name table in bytes.
   The default for the job logical name table size is 1024 bytes. The
   new value takes effect the next time you log in.

   For a detached process, increase the SYSGEN parameter PQL$JTQUOTA.

EXP

file expiration date not yet reached

   Facility: RMS, VMS Record Management Services

   Explanation: A call to a VMS RMS service attempted to overwrite a
   magnetic tape file that is not expired.

   User Action: If the file can be overwritten, remount the volume
   with the /OVERRIDE=EXPIRATION qualifier. (You must be the owner of
   the volume or have the VOLPRO privilege to override the expiration
   date.) Otherwise, use another volume.

EXPAGQUO

exceeded pagefile quota

   Facility: LINK, Linker Utility

   Explanation: The linker could not expand its virtual address space
   sufficiently due to inadequate pagefile quota. Since the PGFLQUOTA
   is shared by a process and all its subprocesses, any one of these
   processes could have used all the quota.

   User Action: If the link fails consistently because of
   insufficient quotas, contact your system manager and request that
   your quota be increased.

EXPANDPHD

expand process header error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

EXPCOMPLEX

expression too complex

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The expression is too complex.

   User Action: Break up the expression into simpler expressions.

EXPECTED

one of the following symbols is expected:

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have a syntax error in your program. One of the
   symbols listed is expected but not found.

   User Action: Correct the syntax error and recompile your program.

EXPGFLQUOTA

exceeded pagefile quota

   Facility: SYSTEM, VMS System Services

   Explanation: An image could not continue executing or a command
   could not execute because the process exceeded its pagefile
   quota. Since the PGFLQUOTA is shared by a process and all its
   subprocesses, any one of these processes could have used the
   entire quota.

   User Action: If a program fails consistently because of
   insufficient quotas, contact your system manager and request that
   your quotas be increased.

EXPIRED

this product has expired after VMS Version nnn. Please contact your
local DIGITAL sales representative.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product cannot be installed on the current
   version of the VMS operating system. The product has been
   restricted to versions lower than the version specified in the
   message.

   User Action: Contact your local DIGITAL sales representative.

EXPORTQUOTA

port's quota exceeded

   Facility: SYSTEM, VMS System Services

   Explanation: The quota permitted by processes on this port of a
   multiport (shared) memory has been exceeded.

   User Action: Wait until other processes release the required
   resource, or reboot VMS and reconnect shared memory specifying
   a larger quota.

EXPOVR32

expression overflowed 32 bits

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The value of the expression could not be stored in a
   longword (32 bits). The assembler truncated the value to 32 bits.

   User Action: Change the values in the expression.

EXPRCLM

exceeded subprocess quota

   Facility: SYSTEM, VMS System Services

   Explanation: An image could not continue executing or a command
   could not execute because the process exceeded its subprocess
   limit.

   User Action: If a program fails consistently because of
   insufficient quotas, contact your system manager and request that
   your quotas be increased.

EXPREG

error code of 'xx' expanding program region

   Facility: PATCH, Patch Utility

   Explanation: The system service $EXPREG request failed due to the
   error represented as 'xx'.

   User Action: Correct the error (represented as 'xx') and retry.

EXPSHRPAT

attempt to expand patch area for shareable image

   Facility: PATCH, Patch Utility

   Explanation: The patch area cannot be created for shareable
   images.

   User Action: Relink the shareable image instead of patching it.

EXPSTKOVR

expression too nested, stack overflow

   Facility: PATCH, Patch Utility

   Explanation: You attempted to evaluate an expression that
   contained more than 16 levels of nested arguments.

   User Action: Remove levels of nested arguments until you have 16
   levels or less and retry the operation.

EXPSYN

invalid expression syntax-check operators and operands

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An arithmetic expression in a DCL command is not
   syntactically correct; the command interpreter cannot analyze the
   expression. An invalid expression can occur as a result of:

   o  Missing operators between values or symbol names

   o  Unmatched parentheses

   o  Undefined symbol names that are being interpreted as character
      string data

   User Action: Examine the expression for any of the errors listed
   above. Correct the expression and reenter the command.

EXPTOOCOM

expression is too complex

   Facility: SMG, Screen Management Facility

   Explanation: The expression is too complex for the termtable
   compiler to parse.

   User Action: Modify the expression so that it is less complex.

EXPVIR

error allocating virtual memory

   Facility: FDL, Create/FDL Utility

   Explanation: This message will be accompanied by a system error
   message that explains the error.

   User Action: Correct the error described in the system error
   message and try again.

EXQUOTA

exceeded quota

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: An image could not continue executing or a command
   could not execute because the process exceeded one of its resource
   quotas or limits.

   If this message is associated with a status code returned by a
   request to a DR32 interface, a DR11-W interface, or an LPA11-K
   driver, the AST quota for the requesting process is exceeded. In
   the latter case, an AST cannot be queued for a buffer full/empty
   AST. Normally, a start data transfer request can require no more
   than three AST blocks at a time.

   If this message is associated with a vector disabled (VECDIS)
   status code, the process's paging file quota prohibits the
   allocation of sufficient process memory for storing its mainline
   vector state.

   If this message is associated with a status code returned by a
   request to a DUP11 interface, a request cannot be queued because
   the buffered I/O quota is exceeded.

   This message can indicate failure to create a subprocess because
   deductible quotas, when subtracted from the current quotas of
   the creator, would not leave the minimum required quotas for the
   creator.

   This message may also occur if the size of a buffered I/O request
   exceeds the value of the SYSGEN parameter MAXBUF.

   User Action: Use the DCL command SHOW PROCESS/QUOTAS to determine
   the current quotas and to determine which quota is exceeded.
   Determine whether any subprocesses are hibernating and are no
   longer performing useful functions; delete any such subprocesses.

   If a program fails consistently because of insufficient quotas,
   contact the system manager and request that the quotas be
   increased.

EXT

ACP file extend failed

   Facility: RMS, VMS Record Management Services

   Explanation: The requested extension of a file cannot be
   performed. This message is associated with a status code returned
   from a file system ACP QIO request made by VMS RMS.

   User Action: The status value (STV) field of the FAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.

EXTBIT

illegal extract bit number-greater than 31

   Facility: PATCH, Patch Utility

   Explanation: You specified an illegal bit number; legal bit
   numbers range from 0 to 31 inclusive.

   User Action: Retry the operation specifying a legal bit number.

EXTCACHIV

contents of extent cache is garbage

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

EXTEND

unable to extend work file for needed space

   Facility: SORT, Sort/Merge Utility

   Explanation: SORT failed to extend your temporary work file.
   Either the device is full or you have reached your disk quota
   limit.

   User Action: Reassign work files to a different device with more
   space or have the system manager extend your quota.

EXTENDED

'filespec' extended

   Facility: SYSGEN, System Generation Utility

   Explanation: This informational message is the result of the
   SYSGEN command CREATE and indicates that the specified file has
   been extended.

   User Action: No action is required.

EXT_ERR

error in RMS Extension; reason code %Xnnnnnnnn

   Facility: RMS, VMS Record Management Services

   Explanation: An RMS extension discovered an error in processing a
   file. This most likely indicates inconsistent data in the file,
   but may indicate that the file has an incorrect STORED_SEMANTICS
   attribute. The reason code is a VMS status code provided by the
   RMS extension.

   User Action: Use the DIRECTORY/FULL command to check the semantics
   of the file being accessed. It may be necessary to manually alter
   the file's semantics attribute using the SET FILE command. Verify
   that the internal structure of the data file is valid.

EXTN_ERR

unable to extend output file

   Facility: CONVERT, Convert Utility

   Explanation: The size of the input file exceeded the initial
   allocation of the output file, and when CONVERT tried to extend
   the file, an error occurred. This message will be accompanied by
   an RMS error message that explains the error.

   User Action: Correct the error described in the RMS error message
   and try again.

EXTNOTFOU

RMS Extension not found

   Facility: RMS, VMS Record Management Services

   Explanation: The semantics of the file being accessed did not
   match the semantics of the attempted access, and no RMS extension
   could be located which could perform the conversion.

   User Action: Use the DIRECTORY/FULL command to check the semantics
   of the file being accessed.

EXTNOTFOUND

extension 'extension-name' not found

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The named extension to VAXTPU cannot be located.

   User Action: Install the named extension before trying to use it.

EXTQELM

exceeded timer queue entry quota

   Facility: SYSTEM, VMS System Services

   Explanation: An image could not continue executing or a command
   could not execute because the process exceeded its timer queue
   entry quota.

   Since the TQELM quota is shared by a process and all its
   subprocesses, any one of the processes could have used all the
   quota.

   User Action: If a program fails consistently because of
   insufficient quotas, contact your system manager and request that
   your quotas be increased.

EXTRACTED

module 'module-name' extracted from 'library-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This success message is generated by the DCL command
   LIBRARY. This message is informational.

   User Action: None.

EXTRAENDM

extraneous .ENDM in 'library-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This warning message is generated by the DCL command
   LIBRARY. The specified library contains a .ENDM line that does not
   terminate any macro.

   User Action: Reformat the macro source file.

EXTRANEOUSARGS

one or more extraneous arguments specified

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have specified one or more extraneous arguments
   for this DECwindows call.

   User Action: Specify only acceptable arguments.

EXTRAPARM

superfluous parameter detected

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You have specified too many parameters in the command
   line. The extra parameter is identified in the message.

   User Action: Reenter your command without the excess parameter.

FAB

file aborted

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR has aborted the file for internal reasons. This
   is a DSR internal error.

   User Action: Submit a Software Performance Report (SPR).

invalid FAB or FAB not accessible

   Facility: RMS, VMS Record Management Services

   Explanation: Either the specified VMS RMS block identifier field
   does not indicate that the field is a FAB, or the FAB is not in a
   portion of memory that can be written to by the caller.

   User Action: Verify that the call to the VMS RMS service is
   coded correctly. An attempt may have been made to perform file
   operations with a RAB. Verify that the FAB is properly initialized
   and that the block identifier field is not overwritten during
   execution of the program image.


FAC

record operation not permitted by specified file access (FAC)

   Facility: RMS, VMS Record Management Services

   Explanation: A record operation is attempted that is not indicated
   in the file access field of the FAB for the file. For example, to
   delete a record, the DEL option must have been specified in the
   FAC field when the file is opened or created.

   If the error results from the DCL command READ or WRITE, this
   message indicates either the DCL command WRITE is entered for a
   file opened for reading, or the DCL command READ is entered for a
   file opened for writing.

   User Action: If the error occurred during execution of an image,
   verify that the FAC parameter in the FAB indicates the requested
   type of access.

   If the error occurred during use of the DCL commands, verify that
   the correct qualifier is specified when the DCL command OPEN is
   entered to open the file.

FACOVFL

facility table overflow in section-please submit SPR

   Facility: MESSAGE, Message Utility

   Explanation: An internal error in the compiler is detected.

   User Action: Submit a Software Performance Report (SPR).

FACTBAD

cannot read factory bad block data

   Facility: INIT, INITIALIZE Command and BACKUP, Backup Utility

   Explanation: Either the DCL command INITIALIZE or the Backup
   Utility encountered an error during an attempt to read the bad
   block data recorded on the specified volume. An accompanying
   message provides additional information.

   User Action: Either correct the condition that caused the error
   and reenter the command or notify the system manager. If the
   volume is under warranty, it should be returned to the factory.
   Contact a DIGITAL field service representative if necessary.

FACTOOLONG

facility name, 'name', exceeds maximum length 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The facility name you want to use is longer than the
   maximum allowed length.

   User Action: Use a shorter facility name.

FAIL

failed to 'execute-verb' entry for 'filespec'

   Facility: INSTALL, Install Utility

   Explanation: A failure to ADD, CREATE, DELETE, REMOVE, or REPLACE
   a known file entry occurred. An accompanying error message
   explains the failure.

   User Action: Correct the situation indicated by the accompanying
   error message and reenter the command.

FAILED

failed to perform 'execute-verb' operation

   Facility: INSTALL, Install Utility

   Explanation: A PURGE or listing operation failed to execute
   completely. An accompanying message explains the failure.

   User Action: Correct the situation indicated by the accompanying
   error message and reenter the command.

Failed to Locate Port Micro-code Image

   Facility: VAXport, VAXport Driver

   Explanation: The port driver will not start the port.

   User Action: Make sure that the console load media is present in
   the console drive, and reboot the system.

FAILFREVM

failed to deallocate 'number' bytes of virtual memory

   Facility: CNF, NI Configurator

   Explanation: An error occurred when NICONFIG attempted to
   deallocate virtual memory.

   User Action: Check the accompanying error message to determine
   whether the virtual address space is exceeded, or whether a
   program error is uncovered. An invalid address or size for
   deallocation indicates a programming error.

FAILGETVM

failed to allocate 'nn' bytes of virtual memory

   Facility: INSTALL, Install Utility

   Explanation: INSTALL failed to allocate sufficient work space for
   itself.

   User Action: Either your PGFLQUO value is too low for your
   account, or the system's VIRTUALPAGECNT SYSGEN parameter is too
   low. Contact your system manager.

failed to allocate 'number' bytes of virtual memory

   Facility: CNF, NI Configurator

   Explanation: An error occurred when NICONFIG attempted to allocate
   virtual memory.

   User Action: Check the accompanying error message to determine
   whether the virtual address space is exceeded, or whether a
   program error is uncovered. An invalid address or size for
   allocation indicates a programming error.


FAILURE

internal VAXTPU failure detected at PC 'address'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

FAILURE_STATUS

facility 'name' returned failure status of 'xxxxxxxx'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A facility that VAXTPU called returned a failure
   status.

   User Action: There is an error in the VAXTPU built-in procedure
   call which generated the error. Correct the parameters and try
   again.

FAIOPEFIL

failed to open file 'filename'

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler could not open the file
   specified in a REQUIRE statement.

   User Action: Make sure that the specified file exists and that you
   have read access to it.

FAO

error formatting report information

   Facility: BAD, Bad Block Locator Utility

   Explanation: An error is encountered during an FAO formatting
   operation.

   User Action: Copy all pertinent diagnostic message information and
   submit a Software Performance Report (SPR).

FAOBUG

FAO system service failure

   Facility: LINK, Linker Utility, CREF, Cross-Reference Utility,
   LIBRAR, LIBRARY Command

   Explanation: An error is returned by the $FAO system service.

   User Action: Submit a Software Performance Report (SPR).

FAOFAIL

FAO failure

   Facility: CREF, Cross-Reference Utility, and LINK, Linker Utility

   Explanation: An error is returned by the $FAO system service.

   User Action: Ensure that the field descriptor FAO control strings
   are correct.

FAO system service failure

   Facility: LIBRAR, LIBRARY Command

   Explanation: An unexpected internal consistency check occurred.

   User Action: Contact your system manager and submit a Software
   Performance Report (SPR).


FATALERR

fatal error on 'save-set-spec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an irrecoverable error
   during an attempt to read or write the specified save set. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

FATALERROR

fatal error message issued

   Facility: LINK, Linker Utility

   Explanation: The linker issued a fatal error message in the link.

   User Action: Correct the problem and relink.

FATALEXC

fatal exception encountered

   Facility: CONVERT, Convert Utility

   Explanation: This message appears if an exception record is
   encountered and if you have specified the /EXIT qualifier.

   User Action: Specify either /TRUNCATE or /PAD, or else specify
   /NOEXIT.

FATALEXCPT

fatal executive or kernel mode exception

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an unrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

FATERRLIB

fatal error in library

   Facility: DTK, DECtalk Facility

   Explanation: An internal error occured in the DECtalk device.

   User Action: Submit a Software Performance Report describing the
   problem.

fatal error in library

   Facility: LIB, Library Facility

   Explanation: An internal consistency check failed in the VMS Run-
   Time Library. This usually indicates a programming error in the
   Run-Time Library.

   User Action: Submit a Software Performance Report (SPR).

fatal error in library

   Facility: SMG, Screen Management Facility

   Explanation: An internal error has occurred within the Screen
   Management Facility.

   User Action: Submit a Software Performance Report describing the
   problem.



FATINTERR

fatal internal error in Run-Time Library

   Facility: OTS, General Purpose Facility, and STR, String
   Manipulation Facility

   Explanation: An explicit or implicit call to the VMS Run-Time
   Library resulted in the failure of an internal consistency check.

   User Action: Rerun your program. Collect as much information as
   possible, including the system traceback listing, and submit a
   Software Performance Report (SPR).

FAU

flag character 'character' already in use

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You attempted to define a character as a flag
   character; however, the character has already been defined.

   User Action: Use another character as a flag character.

FCPREADERR

file processor read error

   Facility: SYSTEM, VMS System Services

   Explanation: An I/O error occurred when file structure data, for
   example, a directory, is being read.

   User Action: Examine the error log and correct the hardware
   problem if necessary.

FCPREPSTN

file processor reposition error

   Facility: SYSTEM, VMS System Services

   Explanation: An I/O error occurred during an attempt to reposition
   a tape volume after it had gone off line.

   User Action: Examine the error log and correct the hardware
   problem if necessary.

FCPREWNDERR

file processor rewind error

   Facility: SYSTEM, VMS System Services

   Explanation: An I/O error occurred when a volume is being rewound.

   User Action: Examine the error log and correct the hardware
   problem if necessary.

FCPSPACERR

file processor space error

   Facility: SYSTEM, VMS System Services

   Explanation: An I/O error occurred while spaces were being skipped
   within a file or files. The operating system does not normally
   display this message.

   User Action: Examine the error log and correct the hardware
   problem if necessary.

FCPWRITERR

file processor write error

   Facility: SYSTEM, VMS System Services

   Explanation: An I/O error occurred when file structure data, for
   example, a directory, is being written.

   User Action: Examine the error log and correct the hardware
   problem if necessary.

FDEXNORCV

expected floating divide by zero exception not received

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error while testing a vector processor's ability to
   generate arithmetic exceptions.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FDLERROR

error parsing FDL file

   Facility: FDL, Edit/FDL Utility

   Explanation: This message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

FDLPAR

error parsing FDL file

   Facility: FDL, Edit/FDL Utility

   Explanation: An error occurred during the parsing of the FDL file.
   This message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message and try again.

FDLPARSE

fatal error encountered parsing FDL file

   Facility: EXCHANGE/NETWORK Command

   Explanation: An error occurred during the parsing of the FDL file
   supplied by the user. This message is issued with an accompanying
   message.

   User Action: Take corrective action based on the accompanying
   message and reenter the command.

FEL

'flag-name' flag at end of line ignored

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This flag cannot occur at the end of a line.

   User Action: Remove the flag from the end of the line.

FEX

file already exists, not superseded

   Facility: RMS, VMS Record Management Services

   Explanation: An attempt is made to create or rename a file with
   the same file specification as an existing file in the volume set.

   User Action: Choose a different file specification; delete the
   existing file (if a new one is to be created); or use the SUP
   option in the FOP parameter in the FAB to request that an existing
   file be superseded.

FFVSDIVER

error encountered testing f_floating vector-scalar division

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during f_floating vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer sevice.

FFVSMLTER

error encountered testing f_floating vector-scalar multiplication

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during f_floating vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FFVSSBTER

error encountered testing f_floating vector-scalar subtraction

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during f_floating vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FFVVADDER

error encountered testing f_floating vector-vector addition

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during f_floating vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FFVVDIVER

error encountered testing f_floating vector-vector division

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during f_floating vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FFVVMLTER

error encountered testing f_floating vector-vector multiplication

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during f_floating vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FFVVSBTER

error encountered testing f_floating vector-vector subtraction

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during f_floating vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FIDERROR

unexpected file change in 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: A file boundary marker is missing from the input
   save set. Data in the save set may be corrupted. It is likely that
   parts of the specified file and one or more complete files are
   missing.

   User Action: Examine the file for corruption and reconstruct
   as necessary. If this error occurs during a disk-to-disk (copy)
   operation, it indicates a software error in the Backup Utility; in
   this case, submit a Software Performance Report (SPR).

FIDNOTFND

internal error. File to be processed not found on process list

   Facility: BACKUP, Backup Utility

   Explanation: The file context has been lost. This is an internal
   error.

   User Action: If this error can be reliably reproduced, the BACKUP
   command used and a description of the circumstances should be
   submitted along with a Software Performance Report (SPR).

FIDNUM_ZERO

file number zero but not a valid deleted header

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: This message is issued along with the BADHEADER
   message and gives a more detailed reason why the specified file
   header is corrupt. In this case, the file number field in the file
   header (FH1$W_FID_NUM or FH2$W_FID_NUM) is zero, indicating that
   this is a deleted header, but the other fields of the file header
   do not have the values that a deleted file header should have.

   User Action: None. See the BADHEADER message.

FIELDLIM

number of fields in range exceeds limit

   Facility: NCP, Network Control Program

   Explanation: The channel list supplied in the command is invalid.
   Channel lists may have eight fields, separated by commas. The last
   field cannot be a hyphenated range.

   User Action: Correct the channel list.

FIL11_NOREC

ignoring /RECORD_FORMAT for Files-11 output

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility does not support the /RECORD_
   FORMAT option on Files-11 output files.

   User Action: Leave the qualifier off. If the output file is not
   in the desired format, use the VMS CONVERT utility to change the
   format of the file.

FILACCERR

magnetic tape file access is nonblank

   Facility: SYSTEM, VMS System Services

   Explanation: The accessibility characteristic in the HDR1 label is
   not blank and the file cannot be accessed without overriding the
   field.

   User Action: Mount the magnetic tape with the
   /OVERRIDE=ACCESSIBILITY qualifier. (The VOLPRO privilege is
   required or you must be the owner of the tape.) Otherwise, use
   another volume.

FILADDED

added component file to phase

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The named startup component file is added to the
   named phase.

   User Action: Verify that the listed file name and phase are
   correct.

FILALRACC

file already accessed on channel

   Facility: SYSTEM, VMS System Services

   Explanation: The request failed because the channel over which
   the $QIO IO$_ACCESS request is issued already had either a file or
   logical link accessed on it.

   User Action: Check for a programming error.

FILAREDIF

files are different

   Facility: DIFF, DIFFERENCES Command

   Explanation: The two files being compared are different. This is
   an informational message.

   User Action: None.

FILCNTNONZ

open file count nonzero after process rundown

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an unrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

FILDISABL

component file updated

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The named startup component file is disabled on the
   specified node.

   User Action: Verify that the listed file name is correct.

FILE_ABSENT

log file not found - /NEW_VERSION not required

   Facility: LMCP, Log Manager Control Program

   Explanation: An attempt was made using the /NEW_VERSION qualifier
   to create a new log file that does not currently exist.

   User Action: To continue with the operation, do not specify the
   /NEW_VERSION qualifier in the command line.

File attributes error

   Facility: EDT, EDT Editor

   Explanation: The file cannot be edited by EDT because of its
   attributes.

   User Action: None. The file cannot be edited.

FILE_EMPTY

log file contains no valid record data

   Facility: LMCP, Log Manager Control Program

   Explanation: An attempt was made to dump or show file usage of a
   log file that contained no valid records.

   User Action: None.

FILE_EXISTS

log file already exists - current file not superseded

   Facility: LMCP, Log Manager Control Program

   Explanation: The log file name specified already exists. This log
   may contain information about currently active transactions that
   will be lost on reboot or failover if a new log file is created.

   User Action: To continue with the operation, specify the /NEW_
   VERSION qualifier in the command line. If you specify /NEW_
   VERSION, a new log file will be created.

File specification required

   Facility: EDT, EDT Editor

   Explanation: You did not specify a file name (or file
   specification) with an INCLUDE, PRINT, or WRITE command.

   User Action: Reenter the command including the correct file
   specification.

FILEACC

error accessing system authorization file

   Facility: LOGIN, Login Processor

   Explanation: An error occurred while attempting to access the
   authorization file. An accompanying message will provide more
   information.

   User Action: Correct the problem described by the accompanying
   message, and try again.

FILECONVERTED

file format is being converted to a supported type

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The buffer being written is created from a file that
   had nonstandard attributes. The output file being created does not
   have the attributes of the input file; it is created with standard
   attributes (VARIABLE with CR record attributes).

   User Action: None.

FILEGONE

startup component database is missing

   Facility: SMI, System Management Intergator/Server

   Explanation: The current startup component database does not
   exist, or you do not have read or write access to this database.

   User Action: To create a new database, use the STARTUP CREATE
   command at the SYSMAN> prompt. To select a different component
   database, use the STARTUP SET DATABASE command at the SYSMAN>
   prompt.

   If the database exists, but you cannot access it, verify the
   protection applied to the file (using the DIRECTORY/FULL command),
   and change the protection if necessary (using the SET PROTECTION
   command). If you cannot change the protection, ask the system
   manager or the owner of the file to change the protection.

FILEIN

'count' lines read from file 'filename'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU opened the named file and read the indicated
   number of lines from that file into a buffer.

   User Action: None.

FILEIO

file I/O error 'filename'

   Facility: NCP, Network Control Program

   Explanation: An error occurred during file input or output; for
   example, a system image file could not be read. An accompanying
   VMS RMS message should identify the reason for the error (such
   as a protection violation if the file is protected against read
   access).

   User Action: Take corrective action based on the VMS RMS message.

FILELOCKED

file is deaccess locked

   Facility: SYSTEM, VMS System Services

   Explanation: The program attempted to access a locked file. A file
   becomes locked when it is accessed with FIB$M_DLOCK (bit) set and
   then deaccessed without writing attributes.

   User Action: Unlock the file with the DCL command UNLOCK and
   examine it for inconsistency.

FILEMPTY

file 'filename' has no folders

   Facility: MAIL, Mail Utility

   Explanation: A DIR/FOLDER command is entered, but the current mail
   file has no folders and, therefore, no messages.

   User Action: None.

FILENABL

component 'filename' updated

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The named startup component file is enabled on the
   specified node.

   User Action: Verify that the listed file name is correct.

FILENOTFOUND

unable to locate file 'filename'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility could not find the listed input
   file.

   User Action: Check the command for a misspelling error, or reenter
   the command specifying the correct location for the input files.

FILENUMCHK

file identification number check

   Facility: SYSTEM, VMS System Services

   Explanation: The volume index file may be corrupted.

   The file number in the file header that is read is invalid. The
   disk's file structure is damaged.

   User Action: Repair the volume with the Verify Utility.

FILEOUT

'count' lines written to file 'filename'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU wrote the indicated number of lines from a
   buffer into the named file.

   User Action: None.

FILEPURGED

oldest file version purged

   Facility: SYSTEM, VMS System Services

   Explanation: The newly created file version exceeded the maximum
   number of versions of that file; the oldest file version is
   deleted. This message is informational.

   User Action: None.

FILESEQCHK

file identification sequence number check

   Facility: SYSTEM, VMS System Services

   Explanation: The file sequence number in the file header is not
   the one expected. A directory entry points to a file that is
   deleted.

   User Action: Remove the directory entry with the following command
   line:

   DELETE filespec

FILESTRUCT

unsupported file structure level

   Facility: SYSTEM, VMS System Services

   Explanation: The file structure on the accessed volume is not
   compatible with the ACP, or the file structure may be corrupt.

   User Action: Verify that the correct physical volume is mounted.
   Or repair the volume with the Verify Utility. If the volume is
   new and does not contain data, use the DCL command INITIALIZE to
   initialize the volume in the correct format.

FILETOOLONG

file only partially installed

   Facility: SYSGEN, System Generation Utility

   Explanation: The SYSGEN command INSTALL failed. The /SIZE
   qualifier specified with the SYSGEN command CREATE is larger than
   the maximum allowed.

   User Action: Specify a smaller /SIZE qualifier with the CREATE
   command.

FILLIM

exceeded open file limit

   Facility: CONVERT, Convert Utility

   Explanation: SORT exceeded the process open file limit.

   User Action: Increase the FILLM parameter in the user
   authorization record.

FILMODIFD

component 'filename' modified

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The named startup component file is modified as
   directed by user.

   User Action: Verify that the listed file name is correct.

FILNOPOST

file will not be subject to date-recording or deletion

   Facility: BACKUP, Backup Utility

   Explanation: This is a warning message indicating that BACKUP
   will not post-process the file because its contents were not
   successfully verified.

   User Action: Determine why the file could not be successfully
   verified and retry the BACKUP operation.

FILNOTACC

file not accessed on channel

   Facility: SYSTEM, VMS System Services

   Explanation: The process is trying to read or write to a channel
   that does not have a file accessed on it.

   User Action: Modify the source program to correct the problem.

FILNOTCNTG

file is not contiguous as required

   Facility: SYSTEM, VMS System Services

   Explanation: A system file that must be in contiguous disk format
   is not contiguous.

   User Action: Use the DCL command COPY/CONTIGUOUS to make a new
   contiguous version of the file.

FILNOTDEL

error deleting 'filespec'

   Facility: Shared by several facilities

   Explanation: A file could not be deleted. This message is usually
   accompanied by a VMS RMS message indicating the reason for the
   failure.

   User Action: Take appropriate action based on the associated VMS
   RMS message.

FILNOTEXP

file is not expired

   Facility: MOUNT, Mount Utility and SYSTEM, VMS System Services

   Explanation: A tape file cannot be overwritten because it has not
   reached its expiration date.

   User Action: To overwrite or delete the file, mount the volume
   with the /OVERRIDE=EXPIRATION qualifier. You must be the owner of
   the volume or have volume protection (VOLPRO) privilege.

FILNOTFND

component file not found

   Facility: SMI, System Management Intergator/Server

   Explanation: A search for startup component files matching a given
   search string found no matching entries.

   User Action: Reenter the command with a different file parameter.

FILNOTPUR

error deleting 'filespec'

   Facility: Shared by several facilities

   Explanation: An error is detected during an attempt to delete the
   specified file. A subsequent message explains the reason for the
   error.

   User Action: Take corrective action based on the accompanying
   message.

FILOPE

file open error, 'name of file'

   Facility: NCP, Network Control Program

   Explanation: Your command could not open the specified file. An
   accompanying VMS RMS message should specify why the file could not
   be opened; for example, the file could not be found. The 'name of
   file' identifies the file that could not be opened, for example,
   the permanent database file.

   User Action: Take corrective action based on the RMS message. For
   instance, if a file cannot be found, determine whether it exists
   and whether it is located in the proper directory.

FILPURGED

'filespec' deleted

   Facility: Shared by several facilities

   Explanation: The DCL command PURGE displays the file specification
   of a file it is deleting. This message is informational.

   User Action: None.

FILREMOVED

component file removed from phase

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The named startup component file is removed from the
   specified phase.

   User Action: Verify that the listed file name is correct.

FILREQD

the /FILENAME qualifier is required with the RMS class

   Facility: MONITOR, Monitor Utility

   Explanation: The RMS class requires a file specification for live
   monitoring.

   User Action: Reenter the MONITOR command with a file specified
   with the /FILENAME qualifier.

FILTOOLON

file specification is too long (over 255 characters)

   Facility: DTK, DECtalk Facility

   Explanation: The file specification is too long.

   User Action: Correct your program so that it requests a file name
   of 255 characters or fewer.

FILTRNERR

input RMS file name is not unique across the CLUSTER

   Facility: MONITOR, Monitor Utility

   Explanation: A single file name specified with the /FILENAME
   qualifier for the RMS class translated to a different file on
   one or more requested nodes. A single file specification must
   locate the same file on all nodes requested.

   User Action: Reenter the MONITOR command with a file specification
   which is unique across the cluster.

FINDHOME

no valid home block, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility could not locate a valid home
   block on the specified relative volume.

   User Action: If the volume can no longer be mounted by the
   operating system, it is corrupted and must be reconstructed from
   backup media. If the volume can be mounted, this message indicates
   a software error in the Verify Utility. In this case, submit a
   Software Performance Report (SPR).

FINDIHD

no valid index file header, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that both the primary and
   alternate index file headers were corrupted.

   User Action: If the volume can no longer be mounted by the
   operating system, it is corrupted and must be reconstructed from
   backup media. If the volume can be mounted, this message indicates
   a software error in the Verify Utility. In this case, submit a
   Software Performance Report (SPR).

FINISHED

task completed

   Facility: UETP, User Environment Test Package

   Explanation: A module in the UETP completed, but errors may have
   occurred during its execution.

   User Action: None.

FIRSTMOD

first input file being a library requires module extraction

   Facility: LINK, Linker Utility

   Explanation: No input files were specified, and the first file is
   a library file with no explicit module extraction.

   User Action: Reenter the command, specifying an input file, or use
   the /INCLUDE qualifier on the library file.

FLAGTRUNC

value of message flags exceeds maximum value 15, truncated

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The message flags value should be less than or equal
   to 15. The procedure for writing the messages uses only the low
   four bits of the value.

   User Action: Refer to the material on SET (MESSAGE_FLAGS, . . . )
   in the VAX Text Processing Utility Manual for the proper values to
   specify.

FLG

invalid key definition flags for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: Either XAB$V_CHG or XAB$V_NUL is incorrectly
   specified for the primary key definition XAB, or a reserved key
   definition flag is specified.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

FLK

file currently locked by another user

   Facility: RMS, VMS Record Management Services

   Explanation: An attempt to open or create a file failed. Another
   user has the file open in a mode incompatible with the attempted
   access.

   User Action: Wait until the other user has unlocked the file. If
   the file is to be shared, verify that the SHR option is selected
   in the FAB for all users that need to access the file. If the file
   cannot be shared, modify the program to detect and respond to the
   condition by waiting.

FLOOVEMAT

floating overflow in math library-user PC location

   Facility: MTH, Mathematics Facility

   Explanation: An overflow condition occurred during execution of
   a math library procedure. This message results from an incorrect
   call to the math library, and usually indicates that an argument
   is too small or too large.

   User Action: Use the traceback information and PC displayed in the
   message to locate where your program called the math library.

FLOUNDMAT

floating underflow in math library-user PC location

   Facility: MTH, Mathematics Facility

   Explanation: An underflow condition occurred during execution of
   a math library procedure and the caller is enabled for floating
   underflow traps. This message results from an incorrect call to
   the math library. Refer to the discussion of the LIB$FLT_UNDER
   procedure in the VMS Run-Time Library Routines Volume.

   User Action: Locate the statement in your program where you called
   the math library causing the underflow condition to occur.

FLOVNORCV

expected floating point overflow exception not received

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error while testing a vector processor's ability to
   generate arithmetic exceptions.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FLTDIV

arithmetic trap, floating/decimal divide by zero at PC = 'xxxxxxxx',
PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An arithmetic exception condition occurred as a
   result of an attempt to divide a floating point/decimal number
   by zero.

   User Action: Examine the PC location displayed in the message;
   check the program listing to verify that operands or variables are
   specified correctly.

FLTDIV_F

arithmetic fault, floating divide by zero at PC = 'xxxxxxxx', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: During a floating-point operation, an attempt is made
   to divide by zero.

   User Action: Examine the PC location displayed in the message;
   check the program listing to verify that operands or variables are
   specified correctly.

FLTOVF

arithmetic trap, floating overflow at PC = 'xxxxxxxx', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An arithmetic exception condition occurred as a
   result of a floating-point overflow.

   User Action: Examine the PC location displayed in the message;
   check the program listing to verify that operands or variables are
   specified correctly.

FLTOVF_F

arithmetic fault, floating overflow at PC = 'xxxxxxxx', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: During an arithmetic operation, a floating-point
   value exceeded the largest representable value for that data type.

   User Action: Examine the PC location displayed in the message;
   check the program listing to verify that operands or variables are
   specified correctly.

FLTPNTSYNX

floating point syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A floating-point constant contained a syntax error.

   User Action: Correct the syntax of the constant.

FLTUND

arithmetic trap, floating underflow at PC = 'xxxxxxxx', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services, LIB, Library Facility

   Explanation: An arithmetic exception condition occurred as a
   result of floating-point underflow.

   User Action: Examine the PC location displayed in the message;
   check the program listing to verify that operands or variables are
   specified correctly.

FLTUND_F

arithmetic fault, floating underflow at PC = 'xxxxxxxx', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: During an arithmetic operation, a floating-point
   value became less than the smallest representable value for that
   data type.

   User Action: Examine the PC location displayed in the message;
   check the program listing to verify that operands or variables are
   specified correctly.

FLUNNORCV

expected floating point underfow exception not received

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error while testing a vector processor's ability to
   generate arithmetic exceptions.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

FLUSH

output stream flush requested

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont output
   routine requesting the output stream be flushed.

   User Action: None.

FNA

flag not allowed in this context: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: (1) A flag is used that requires that text directly
   precede or follow it; or (2) a flag character is replaced by
   another character (by means of a .FLAGS command) and the previous
   function of the replacement has not been disabled (by means of a
   .NO FLAGS command).

   User Action: Check your usage of the flag, and make the
   appropriate correction.

invalid file name string address

   Facility: RMS, VMS Record Management Services

   Explanation: Either the file specification string address field in
   the FAB is incorrect, or is in a portion of memory that cannot be
   read by the caller.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. Specifically, check that the address specified points
   to the correct string.


FND

ACP file or directory lookup failed

   Facility: RMS, VMS Record Management Services

   Explanation: An error occurred during a directory search. This
   message is associated with a system status code returned from a
   file system ACP QIO request made by VMS RMS.

   User Action: The status value (STV) field of the FAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.

FNF

error opening 'filename'

   Facility: FDL, Edit/FDL Utility

   Explanation: The Edit/FDL utility could not open the specified
   file.

   User Action: Verify that the device, directory, file name,
   and file type are correctly specified. (If a logical name is
   specified, check its current equivalence value. If the equivalence
   value is correct, verify that the correct volume is mounted on the
   specified device and that the file is on the volume. If the file
   specification is incorrect, use the appropriate specification.)

file not found

   Facility: RMS, VMS Record Management Services

   Explanation: The specified file does not exist.

   User Action: Check the file specification and verify that the
   device, directory, file name, and file type were all specified
   correctly. If a logical name is specified, verify the current
   equivalence assigned to the logical name. If the equivalence
   is correct, verify that the correct volume is mounted on the
   specified device and that the file is not inadvertently deleted.
   Specify the existing file.

file not found

   Facility: SYSGEN, System Generation Utility

   Explanation: SYSGEN is unable to locate the driver image file.
   The default directory and disk device for driver images is
   SYS$SYSTEM. This message is also produced during an AUTOCONFIGURE
   operation if a UNIBUS device does not have a corresponding driver
   in SYS$SYSTEM.

   User Action: Restore the image file to the system disk from a
   backup disk.



FNM

error in file name

   Facility: RMS, VMS Record Management Services

   Explanation: The file name portion of a file specification is
   specified incorrectly. For example, the file name contains more
   than 39 characters. Or the use of a logical name resulted in more
   than one file name in the file specification.

   User Action: Verify the syntax of the file name in the file
   specification or in the logical name, if a logical name is
   specified.

FOP

invalid file options

   Facility: RMS, VMS Record Management Services

   Explanation: The file options parameter in the FAB contains
   conflicting options. In particular, the UFO or NFS options were
   specified on an indirect open of a process permanent file.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

FORCEDERROR

forced error flagged in last sector read

   Facility: SYSTEM, VMS System Services

   Explanation: This message applies only to devices governed by the
   Mass Storage Control Protocol (MSCP). The data in this sector is
   copied from another sector that had unrecoverable read errors.
   This data is written with the Forced Error Indicator set to show
   to subsequent readers that the data is questionable.

   User Action: Be aware that the contents of the sector are only a
   close approximation of the data. Use the Backup Utility to make a
   copy of the original file and recover its contents.

FORCEDEXIT

forced exit of image or process by Job Controller

   Facility: SYSTEM, VMS System Services

   Explanation: When the job controller detects a violation of the
   login hour restrictions specified in the authorization record for
   a user, the job controller forces the process to terminate.

   User Action: See your system manager.

FORGET

participant has no further need for this transaction state

   Facility: SYSTEM, VMS System Services

   Explanation: The resource manager issued a call declaring that
   none of the effects of the transaction should be applied.

   User Action: None.

FORM_ABORT

record contents invalid - format aborted

   Facility: LMCP, Log Manager Control Program

   Explanation: An attempt was made to dump formatted records that
   contained invalid data. The dump of these records continues in
   hexadecimal format only.

   User Action: Submit a Software Performance Report (SPR) describing
   the conditions leading to the error and include a BACKUP save set
   containing the output of the LMCP DUMP and the DCL DUMP commands
   for the given log file.

FORMAT

file has illegal format

   Facility: LINK, Linker Utility

   Explanation: This is a secondary message indicating the object
   file in question has an illegal format.

   User Action: Correct the source, recompile, and relink.

invalid media format

   Facility: SYSTEM, VMS System Services

   Explanation: An I/O operation failed because the data medium is
   not in a format that the device driver expected. If this message
   is associated with a status code returned by a request to a
   magtape, the format specified by the last set tape characteristics
   function is not implemented in the slave controller.

   User Action: Verify the physical data pack, reel, or cartridge to
   ensure that the correct data medium is mounted. Contact a DIGITAL
   field service representative if necessary. If the error occurred
   while initalizing a diskette, reissue the INITIALIZE command using
   the /DENSITY qualifier.


FORWLOOP

infinite forwarding detected sending to user 'username'

   Facility: MAIL, Mail Utility

   Explanation: A forwarding loop is created. This message is
   generated after the Mail Utility has gone through the loop ten
   times.

   User Action: Determine what caused the loop.

FPART_SECTN

unable to repair log with partially written section(s)

   Facility: LMCP, Log Manager Control Program

   Explanation: While scanning for active transactions, the REPAIR
   facility located sections that have been partially written.
   The REPAIR facility has been aborted, as it cannot reconstruct
   sections that may be required for repair.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and include a BACKUP
   save set containing the output of the LMCP DUMP and the DCL DUMP
   commands for the given log file.

FREEBADBUF

attempted to free busy (or free) buffer

   Facility: BACKUP, Backup Utility

   Explanation: A software error occurred in BACKUP.

   User Action: Submit a Software Performance Report (SPR).

FREEMEM

error freeing virtual memory

   Facility: BACKUP, Backup Utility and ANALDISK, Analyze/Disk_
   Structure Utility

   Explanation: Either the Backup Utility or the Verify Utility
   encountered an error during an attempt to free dynamic virtual
   memory. The accompanying message provides additional information.
   This message indicates a software error in either the Backup
   Utility or the Verify Utility.

   User Action: Submit a Software Performance Report (SPR).

memory deallocation failure

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).


FREEPAGREF

free page reference count is nonzero

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an unrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

FREEVM

deallocated 'number' bytes of virtual memory leaving 'number'

   Facility: CNF, NI Configurator

   Explanation: The VM bit is set in NICONFIG$LOG. Virtual memory has
   been deallocated and the amount is tallied.

   User Action: None.

FRERANGE

storage package range error

   Facility: PATCH, Patch Utility

   Explanation: An internal error has occurred.

   User Action: Submit a Software Performance Report (SPR).

FRESIZE

storage package size error

   Facility: PATCH, Patch Utility

   Explanation: An internal PATCH error has occurred.

   User Action: Submit a Software Performance Report (SPR).

FREWSLX

free working set list index, resource wait

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an unrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

FROMBUILTIN

called from built-in 'built-in-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message shows the name of the built-in calling
   the code that generated the error.

   User Action: None.

FROMLINE

called from line 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message shows the line number where the error
   occurred.

   User Action: None.

FROMPROCLINE

called from line 'integer' of procedure 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message shows the line number within procedure
   of the caller where the error occurred.

   User Action: None.

FRZNCTX

context is frozen - either cancel this context or use alternate

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You are attempting to use the F$CONTEXT lexical to
   add context information to a symbol. A context symbol cannot be
   changed after it has been referenced by an appropriate lexical
   function other than F$CONTEXT, which requires a context symbol.

   User Action: You must either use another symbol or use the cancel
   function of F$CONTEXT to erase the context from this symbol.

FSZ

invalid fixed control header size

   Facility: RMS, VMS Record Management Services

   Explanation: The fixed control area size of the FAB for the file
   does not contain the correct value. Files that have the print file
   record format must have an FSZ value of 2.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

FTM

network file transfer mode precludes operation (SQO set)

   Facility: RMS, VMS Record Management Services

   Explanation: For network file access, the FAB file option SQO
   selects DAP (Data Access Protocol) file transfer mode. In
   this mode of operation, data records are blocked together for
   transmission over the network to increase data throughput and
   reduce CPU overhead. Selection of DAP file transfer mode limits
   data transfers to one direction (either transmit using $PUT
   /$WRITE or receive using $GET/$READ). Other VMS RMS services are
   disallowed except for $DISCONNECT and $CLOSE, which terminate file
   transfer mode.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. Modify the source program to either not request the
   prohibited services or not specify the SQO FOP option in the FAB.

FUL

device full (insufficient space for allocation)

   Facility: RMS, VMS Record Management Services

   Explanation: A $CREATE, $EXTEND, or $PUT operation for a file
   failed because there is not enough space on the volume.

   User Action: Delete or purge as many files as possible to provide
   usable space on the volume, or request the system operator to do
   so. If the volume is private and files cannot be deleted, obtain a
   new volume.

FUNNOTSUP

function not supported

   Facility: PSM, Print Symbiont

   Explanation: This status is returned indicating the current
   function is not supported by the user service. For future
   compatibility, user services should return this status for any
   unrecognized function code.

   User Action: None.

FUTBAKDAT

file ('file-id') 'filename' backup date is in the future

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the date of the last
   backup recorded for the file is later than the current date. The
   utility sets the backup date to the current date.

   User Action: None.

FUTCREDAT

file ('file-id') 'filename' creation date is in the future

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the creation date
   recorded for the file is later than the current date. The utility
   sets the creation date to the current date.

   User Action: None.

FUTREVDAT

file ('file-id') 'filename' revision date is in the future

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the date of the last
   modification recorded for the file is later than the current date.
   The utility sets the revision date to the current date.

   User Action: None.

FWF

footnotes won't fit on page

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: There are too many footnotes in the input file, or
   there are too many lines in a footnote.

   User Action: Reduce the number or size of the footnotes.

GBC

invalid global buffer count

   Facility: RMS, VMS Record Management Services

   Explanation: An incorrect global buffer count value is specified.
   The global buffer count value must be in the range of 0 to 32,767.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

GBLNDF

cannot define symbol-global symbol scoping is enabled

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You are trying to define a global symbol after using
   the SET SYMBOL /SCOPE=NOGLOBAL command. Global symbols cannot be
   accessed or defined while symbol scoping is set to be NOGLOBAL.
   This can be reset with the SET SYMBOL /SCOPE=GLOBAL command.

   User Action: Check your command procedure. Either change the
   symbol scoping to GLOBAL, or use local symbols.

GBLNOTCRE

global section not created

   Facility: SMG, Screen Management Facility

   Explanation: The system program that maps TERMTABLE.EXE as a
   global section is unsuccessful.

   User Action: This message should be handled only by system
   managers. If there is already an existing global section for
   Termtable, the system must be rebooted in order to create a new
   global section.

GBLONLY

cannot obtain global copy of image section 'image-section'

   Facility: PATCH, Patch Utility

   Explanation: The image being patched references a global copy of
   an image section. There is no local copy of this section within
   the image file.

   User Action: To patch such a section, you must patch the shareable
   image file in which it is contained.

GBLPAGSZRO

Global page share count is zero

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

GBLSECMAP

system terminal table used

   Facility: SMG, Screen Management Facility

   Explanation: The requested terminal definition is found in the
   system Termtable. The requested terminal definition did not exist
   in the caller's private Termtable.

   User Action: None.

GBLSELOWNER

you are the global selection owner

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This VAXTPU session is the global selection owner.

   User Action: Because you own the global section, you must process
   it yourself.

GBLWARN

patching local copy of global image section 'image-section'

   Facility: PATCH, Patch Utility

   Explanation: The image being patched: (1) references a global
   image section, (2) contained a local copy of the global image
   section (only the local copy is being patched), (3) is no longer
   allowed to use the shared global section.

   User Action: Patch the shareable image instead of the executable
   image, if you want to continue sharing the global section. You
   must reinstall the shareable image after it is patched.

GBLWSLXERR

Global working set list entry not found

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

GENERR

generated ERROR: 'xxxxx' message

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A .ERROR directive is assembled; 'xxxxx' is the value
   of the expression specified in the directive; and message is the
   text specified in the directive.

   User Action: Follow the instructions in the message.

GEN_MAX

generic queue limit reached

   Facility: JBC, Job Controller

   Explanation: A maximum of eight generic queues can feed a specific
   execution queue. This message indicates that you attempted to make
   an execution queue the target of too many generic queues.

   User Action: None. This is a restriction.

GENMINUS1

shadow set virtual unit generation number invalid on 'device'

   Facility: BACKUP, Backup Utility

   Explanation: An attempt has been made to use BACKUP on a member of
   a shadow set which has not yet been fully formed.

   User Action: Wait for the shadow set to be fully formed and retry
   the BACKUP operation.

GENWRN

generated WARNING: 'xxxxx' message

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A .WARN directive is assembled; 'xxxxx' is the value
   of the expression specified in the directive; and message is the
   text specified in the directive.

   User Action: Follow the instructions in the message.

GETCHN

error getting device characteristics

   Facility: DUMP, File Dump Utility

   Explanation: The File Dump Utility encountered an error during an
   attempt to obtain the device characteristics of the input device.
   The accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

error getting device characteristics for 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to obtain the device characteristics of the input device.
   The accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.


GETDVI

error getting device characteristics, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error in an attempt
   to get the device characteristics of the specified relative
   volume. The accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.

error obtaining device information for 'device-name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: An error is encountered while attempting to obtain
   information regarding the device.

   User Action: Examine the associated diagnostic messages, making
   corrections where appropriate.


GETERR

get error

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.

read error code of 'xx' on file 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: A VMS RMS $GET read request failed due to the error
   represented as 'xx'.

   User Action: Correct the error (represented as 'xx') and retry.


GETJPI

failed to obtain default job and process information

   Facility: RUN, Run Detached Utility

   Explanation: The system service $GETJPI failed to get process and
   job information used to create new subprocess or detached process.

   User Action: See error codes returned by the $GETJPI system
   service to determine action.

GETJPIERR

error from SYS$GETJPI

   Facility: ERF, Error Log Utility

   Explanation: This message indicates an internal consistency error.

   User Action: Submit a Software Performance Report (SPR).

GETMEM

Memory allocation failure

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU is attempting to allocate memory for its data
   structures, but there is not sufficient free memory for it to do
   so. This error may occur if you are using an extremely complex
   editing environment.

   User Action: First, delete unneeded strings, ranges, markers,
   windows, and buffers, then reenter your command. If the
   error reoccurs, increase the value of the SYSGEN parameter
   VIRTUALPAGECNT. If the available memory is still insufficient for
   your editing environment, try to increase your account's page file
   quota. Finally, if the error persists, ask your system manager to
   increase available memory.

GETMSG

error obtaining message text

   Facility: BAD, Bad Block Locator Utility

   Explanation: An error is encountered while attempting to obtain
   message text.

   User Action: Copy all pertinent diagnostic message information and
   submit an SPR to DIGITAL.

GETPTIERR

error from $GETPTI, buffer 'number', image VPN 'decimal-number' for
'decimal-number' pages

   Facility: LINK, Linker Utility

   Explanation: An error is returned from the $GETPTI system service.

   User Action: Submit a Software Performance Report with all
   relevant programs, listings, object files, and library files.

GETTIM

error code of 'xx' on $GETTIM

   Facility: PATCH, Patch Utility

   Explanation: The $GETTIM system service request failed due to the
   error represented as 'xx'.

   User Action: Correct the error and retry.

GETVM

allocated 'number' bytes of virtual memory, total of 'number'

   Facility: CNF, NI Configurator

   Explanation: The VM bit is set in NICONFIG$LOG. Virtual memory has
   been allocated and the amount is tallied.

   User Action: None.

GFC

given footnote count incorrect, correct value is n

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The actual number of lines generated for the footnote
   is greater or less than the count specified with the .FOOTNOTE n
   command.

   User Action: None. This is an informational message. If you do not
   want the message to appear, remove the number from the .FOOTNOTE
   command.

GFVSADDER

error encountered testing g_floating vector-scalar addition

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during g_floating vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

GFVSDIVER

error encountered testing g_floating vector-scalar division

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during g_floating vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

GFVSMLTER

error encountered testing g_floating vector-scalar multiplication

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during g_floating vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

GFVSSBTER

error encountered testing g_floating vector-scalar subtraction

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during g_floating vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer sevice.

GFVVADDER

error encountered testing g_floating vector-vector addition

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during g_floating vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

GFVVDIVER

error encountered testing g_floating vector-vector division

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during g_floating vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

GFVVMLTER

error encountered testing g_floating vector-vector multiplication

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during g_floating vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

GFVVSBTER

error encountered testing g_floating vector-vector subtraction

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during g_floating vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

GOSUBMAX

GOSUB procedures too deeply nested-limit to 16 levels

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You are nested at the maximum level of subroutines
   and tried to transfer control to another lower level.

   User Action: Modify your command procedure so that it does not
   nest so deeply. Also ensure that you have a RETURN statement at
   the end of each subroutine.

GPGNULPGFL

global page has null page file address

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

GPTFULL

global page table is full

   Facility: SYSTEM, VMS System Services

   Explanation: Not enough space is available in system memory to
   maintain information about global sections. This message indicates
   a system error resulting from insufficient allocated space in the
   global page table.

   User Action: Notify your system operator or system manager to
   increase the SYSGEN parameter GBLPAGES.

GRANTERR

unable to grant identifier 'id-name' to 'user-id'

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specified resource identifier cannot be granted
   to the specified user ID. This message should be accompanied by
   a second message showing the specific reason why the identifier
   could not be granted.

   Resource identifiers are granted to UIC-format identifiers.
   Typically, this error occurs either because the specified resource
   identifier does not exist or because the target user ID is not a
   UIC-format identifier. The latter can occur when multiple accounts
   have the same UIC.

   User Action: Correct the condition identified by the second
   message and reenter your command.

GRANTMSG

identifier 'id-name' granted to 'user-id'

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specified general identifier has been granted
   to the specified user. The user has access to all of the rights
   associated with the identifier.

   User Action: None.

GSDFULL

global section descriptor table is full

   Facility: SYSTEM, VMS System Services

   Explanation: The system cannot create or map a global section
   because the system space allocated for global section data is
   full. This message usually indicates that the system is not
   generated with sufficient space for global section descriptors.

   User Action: Wait and retry the request. If the failure persists,
   notify the system manager.

GSDTYP

illegal GSD record type ('number') in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: An illegal GSD Record type is found in the specified
   object module.

   User Action: Submit a Software Performance Report on the
   appropriate language compiler.

illegal GSD record type 'record-type' in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

module 'module-name' file 'library-filespec' has an illegal GSD
record 'record-type'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. The specified object module is illegally formatted.

   User Action: Recompile the object module before inserting it into
   the library.


HALT

halt instruction restart

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

HALTED

transfer has been halted

   Facility: Shared by several facilities

   Explanation: If this message is returned from a DR32 support
   routine call, the DR32 transfer is complete.

   User Action: If the DR32 transfer halted unexpectedly, determine
   the cause of the error.

HANGUP

data set hang-up

   Facility: SYSTEM, VMS System Services

   Explanation: The associated terminal data set has been hung up. A
   CTRL/Y or unsolicited data AST is delivered.

   User Action: None.

HBREAD

error reading home block of 'volume-name'

   Facility: SET, SET Facility

   Explanation: An error occurred while trying to read the home block
   of a volume. This message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

HBWRITE

error writing home block of 'volume-name'

   Facility: SET, SET Facility

   Explanation: An error occurred while trying to write to the home
   block of a volume. This message is issued with an accompanying
   message.

   User Action: Take corrective action based on the accompanying
   message.

HDRBLK

too many ISDs for image header blocks

   Facility: PATCH, Patch Utility

   Explanation: You requested too many image section descriptors;
   PATCH is unable to create this patch area.

   User Action: Relink your image file.

HDRCRC

software header CRC error

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the header CRC field
   (BBH$W_CHECKSUM) of a save set block. Data in the save set is
   corrupted.

   User Action: None. The save set data is lost.

HDRERRS

errors occurred writing the dump file header blocks

   Facility: SDA, System Dump Analyzer

   Explanation: The first block of the dump file contains information
   indicating that there were errors while writing out the dump
   header.

   User Action: None. The dump file might not be useful for analysis.

HDRNOTMAP

allocated file header not mapped

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

HDRNOTRES

unable to make image header resident

   Facility: INSTALL, Install Utility

   Explanation: Insufficient pool is available to make the header
   resident, or the file has an image header larger than one block.

   User Action: Use the SYSGEN parameter PAGEDYN to increase
   the pool. Only files with one block image headers may be made
   resident.

HDRTRUNC

header truncated

   Facility: LBR, Librarian Subroutine Package

   Explanation: This warning message is generated by the Librarian
   routines. The buffer supplied to LBR$SET_MODULE is smaller than
   the header.

   User Action: Supply a larger buffer to LBR$SET_MODULE.

HEADCOPIED

copied 'file-header' header

   Facility: BACKUP, Backup Utility

   Explanation: The /LOG message indicating that a file header only
   is copied. The file is marked NOBACKUP; therefore, no data is
   saved.

   User Action: None.

HEADER_DEL

deleted file header

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: This message is issued along with the BADHEADER
   message and gives a more detailed reason why the specified file
   header is bad. In this case, the file header has the format of a
   deleted header. Additional messages indicate why a deleted file
   header is invalid in this context.

   User Action: None. See the BADHEADER message.

HEADERFULL

file header is full

   Facility: SYSTEM, VMS System Services

   Explanation: The file header map area on the volume is full and
   cannot be extended. This error occurs only when the file header
   extension is inhibited, for example, when the index file is being
   extended.

   User Action: Compress the volume by copying it with BACKUP.

HELP

enter HELP for INSTALL help

   Facility: INSTALL, Install Utility

   Explanation: This is an informational message.

   User Action: Enter HELP for INSTALL help.

Help file could not be closed

   Facility: EDT, EDT Editor

   Explanation: You specified the name of a HELP file that EDT is
   unable to close. Some problem exists at the system level that
   prevents EDT from closing the file.

   User Action: After determining the cause of the system problem,
   correct it.

Help file could not be opened

   Facility: EDT, EDT Editor

   Explanation: The requested EDT HELP file cannot be accessed.
   An error in system storage has occurred (for example, improper
   installation of the operating system).

   User Action: Verify that the logical name EDTHELP (with a default
   of SYS$HELP:.HLB) designates the EDT HELP file, and that the file
   has not been damaged.

Help File Index could not be initialized

   Facility: EDT, EDT Editor

   Explanation: You created a new EDT HELP file or modified an
   existing EDT HELP file, but either you neglected to include an
   index number or you placed an indexed entry out of the proper
   nested order.

   User Action: Include the omitted index number or place the indexed
   entry in the proper nested order.

HELPERR

error finding or outputting HELP information

   Facility: AUTHORIZE, Authorize Utility

   Explanation: An error occurred trying to access the AUTHORIZE HELP
   file.

   User Action: Check that the AUTHORIZE HELP file, by default
   named UAFHLP.HLB, is located in the proper directory and is not
   protected against read access.

HELP command error

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during execution of the HELP
   command of the Monitor Utility. More information may be obtained
   by examining the accompanying message.

   User Action: Correct the error indicated by the accompanying
   message and rerun the HELP command. This error can occur when
   the MONITOR help library (SYS$HELP:MNRHELP.HLB) cannot be located
   or accessed.


HIB

hibernating until requested beginning time . . .

   Facility: MONITOR, Monitor Utility

   Explanation: Monitoring of the running system is requested,
   beginning at a future time. The process that issued the MONITOR
   request is placed in the hibernate state until the requested
   beginning time, at which time monitoring will begin. This is an
   informational message.

   User Action: If monitoring at a future time is desired, no user
   action is required. If, however, the /BEGINNING qualifier is
   incorrectly specified and if future monitoring is not desired,
   cancel the MONITOR request and reenter it.

HIBER

hibernating until 'time'

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: This is an informational message that is
   returned when the SHOW CLUSTER command is invoked with the
   /BEGINNING=beginning-time qualifier. The message indicates that
   the current process will be suspended until the time indicated.

   User Action: None.

HIDDEN

global variable 'name' by declaration

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have declared a parameter, local, or constant
   that has the same name as a global variable. Your declaration
   hides the global variable.

   User Action: None.

High Priority Command Queue Insert Failure

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the port;
   after 50 failed attempts it marks the device off line.

   User Action: Call DIGITAL Field Service. This error is caused by a
   failure to obtain access to an interlocked queue. Possible sources
   of the problem are CI hardware failures or memory, SBI (11/780),
   CMI (11/750), or BI (8200, 8300, and 8800) contention.

HIGHVER

higher version of 'output-filespec' already exists

   Facility: Shared by several facilities

   Explanation: An explicit version number is requested for an output
   file; the directory already contains an entry for the same file
   name and file type with a higher version number.

   User Action: None. The message is informational. Note that if
   the file is subsequently specified in a command, the system will
   locate the previously existing version if no version number is
   specified. The newly created output file will not be used.

HISTERR

error accessing library update history in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: An error occurred while accessing the library update
   history records. This message is issued with an accompanying
   message.

   User Action: Take corrective action based on the accompanying
   message.

HOMBLKBAD

primary home block is bad; backup used

   Facility: MOUNT, Mount Utility

   Explanation: The primary home block of a disk is corrupted or
   unreadable; the backup volume is used to mount the volume.

   User Action: Repair the disk with the Verify Utility.

HOMBLKCHK

home block software consistency check

   Facility: MOUNT, Mount Utility

   Explanation: The home block in the volume has failed the software
   consistency check during /BIND processing. The first occurrence of
   this message is a warning; the second is fatal.

   User Action: Repair or reinitialize the volume and retry the
   operation.

HRDFAI

hardware failure

   Facility: NCP, Network Control Program

   Explanation: The hardware associated with the request could not
   perform the function required.

   User Action: Contact your system manager or a DIGITAL field
   service representative.

HSC Error Logging Datagram Received

   Facility: VAXport, VAXport Driver

   Explanation: Upon receiving an error message from the HSC, the
   CI port driver logs the error and takes no other action. Since
   HSC informational error log datagrams are also recorded on the
   HSC console, it is useful to read them only if the HSC console
   does not record them for some reason (if it runs out of paper, for
   example).

   User Action: You should disable the sending of HSC informational
   error log datagrams with the appropriate HSC console command,
   since HSC informational error log datagrams take up considerable
   space in the error log data file.
I/O error on work file

   Facility: EDT, EDT Editor

   Explanation: EDT is unable to access its text storage area for the
   file. An additional message will explain the error further, such
   as "Device full" or "Device write locked".

   User Action: Correct the problem described in the file system
   message.

IAL

invalid argument list

   Facility: RMS, VMS Record Management Services

   Explanation: The argument list in a call to SYS$RMSRUNDWN,
   SYS$SETDDIR, or SYS$SETDFPROT control routines either cannot be
   accessed or contains invalid data.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

IAN

invalid index area number for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The index area number specified in a key definition
   XAB is not a defined area for the file.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

IBF

illegal bucket format in VBN = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS detected a corrupted bucket in an indexed
   file. Incorrect bucket control flags or an incorrect bucket
   freespace value is detected.

   User Action: Reorganize the file with the CONVERT command, or re-
   create the file. The status value (STV) field of the FAB or RAB
   contains the starting virtual block number of the bucket in error.

   This error is caused by hardware errors, VMS RMS or system
   software errors, or inadvertent modifications of files by non-RMS
   programs.

IBK

LAN bucket size not equal IAN bucket size for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The bucket size for the index area specified by IAN
   must be the same as the bucket size of the lowest-level index area
   specified by LAN.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly. In particular, determine that
   the correct area numbers and sizes were specified for the index
   and lowest-level index areas.

IBO

input buffer overflow: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A character string that is too long was entered in an
   internal line buffer. This is a DSR internal error message.

   User Action: Submit a Software Performance Report (SPR).

ICONCLUDAT

inconsistent cluster database

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ICONPFNDAT

inconsistent PFN database

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ICPAGELOC

inconsistent page location

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ICVNOTFND

input converter not found

   Facility: CDA

   Explanation: The specified input converter could not be found.

   User Action: Check the format specified for the input file for
   errors. See if the file SYS$LIBRARY:'domain'$READ_'format'.EXE
   exists, where 'domain' is DDIF for document formats or DTIF for
   tabular formats and 'format' is the input format specified by the
   calling applicattion or the CONVERT/DOCUMENT command line.

IDD

invalid display descriptor: "text in error"

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You specified an incorrect descriptor in a .DISPLAY
   directive.

   User Action: Correct the specified descriptor.

IDENT

DSRTOC version 'version-number'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: This message is displayed when the /IDENTIFICATION
   qualifier is specified. It shows the version number of the DSR
   Table of Contents Utility. This message is informational.

   User Action: None.

standalone BACKUP 'string'; the date is 'date and time'

   Facility: BACKUP, Backup Utility

   Explanation: This is a standalone BACKUP identification message.

   User Action: Make sure that the displayed data is correct.


IDMISMATCH

ident mismatch with global section or shareable image

   Facility: SYSTEM, VMS System Services

   Explanation: The ident is part of the global section name. An
   attempt is made to create a shared memory global section using
   a different ident with a name that is the same as that of an
   existing shared memory section.

   This error occurs when an attempt is made to install an image
   in shared memory (MA780) from two processors that do not have
   identical image files.

   User Action: Copy the file from one processor to the other and
   retry the operation.

section NOT restored, section file must be rebuilt

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This version of VAXTPU is not compatible with the
   section file that you are trying to access.

   User Action: Save the section file again by running the source
   file through the version of VAXTPU you are trying to use.


IDMISMCH

GSMATCH of 'number,number' in shareable image 'image-name' differs
from GSMATCH of 'number,number' in shareable image library 'library-
name'

   Facility: LINK, Linker Utility

   Explanation: A shareable image extracted from a shareable image
   library has a different GSMATCH than the GSMATCH recorded for that
   shareable image in the library.

   User Action: Insert the new shareable image into the shareable
   image library using the DCL command LIBRARY.

IDOUTRNG

identifier value is not within legal range

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The value you specified for an identifier is not
   within the permissible range. A general identifier may have an
   integer value between 32,768 and 268,435,455. A UIC identifier
   takes a value in standard UIC format.

   User Action: Reenter your command with an identifier value that is
   within the permissible range.

IDR

invalid directory rename operation

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $RENAME service is requested that would
   rename a directory file into a directory tree that contained
   the directory file. The directory would then be inaccessible.
   An example of incorrect usage is:

   $RENAME [A]B.DIR [A.B]

   User Action: Modify the program or reenter the command specifying
   the correct old and new file specifications for the $RENAME
   service.

IDX

index not initialized

   Facility: RMS, VMS Record Management Services

   Explanation: The index of an indexed file could not be properly
   initialized when inserting the first record.

   User Action: Re-create the file. Collect as much information as
   possible and submit a Software Performance Report (SPR).

IDXCONCAT

index file cannot be concatenated

   Facility: Shared by several facilities

   Explanation: An index file may not be concatenated with another
   file.

   User Action: Use an indexed file load program to load the indexed
   file.

IDXFILEFULL

index file is full

   Facility: SYSTEM, VMS System Services

   Explanation: No more files can be written on the volume, because
   the maximum size of the index file specified is reached when the
   volume is initialized.

   User Action: If the volume is a private volume, delete the
   unwanted files on the volume. If the volume is a system volume,
   notify the system operator or system manager.

IDXHDRBAD

index file header is bad; backup used

   Facility: MOUNT, Mount Utility

   Explanation: This message is generated by the DCL command MOUNT.
   The primary index file header is corrupted or unreadable; the
   backup volume is used to mount the volume.

   User Action: Repair the volume with the ANALYZE/DISK_STRUCTURE
   /REPAIR command.

IDX_LIM

exceeded maximum index level

   Facility: CONVERT, Convert Utility

   Explanation: The index tree depth exceeded 32 levels.

   User Action: Redesign the file to make it more shallow.

IDXMAPERR

I/O error on index file bitmap; volume locked

   Facility: MOUNT, Mount Utility

   Explanation: I/O error encountered during a mount operation.
   Existing files in the volume can be accessed but other operations,
   for example, create and delete, are not possible.

   User Action: Repair the volume with the ANALYZE/DISK_STRUCTURE
   /REPAIR command.

IFA

illegal file attributes detected (file header corrupted)

   Facility: RMS, VMS Record Management Services

   Explanation: The content of the file header was corrupted; the
   data is inconsistent and cannot be read.

   User Action: Depending on the operation, the status value
   (STV) field in the FAB or RAB contains a system status code
   that provides additional information about the condition.
   Take corrective action based on this status code. If the error
   persists, collect as much information as possible and submit a
   Software Performance Report (SPR).

IFDIRSYNX

IF directive syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A conditional assembly directive contained a syntax
   error.

   User Action: Correct the syntax of the directive.

IFEXPRNABS

IF expression not absolute

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The expression in an .IF directive is not an absolute
   expression or contained undefined symbols.

   User Action: Change the values in the expression.

IFF

invalid file attributes for requested file access

   Facility: RMS, VMS Record Management Services

   Explanation: The attributes of the file do not permit the type
   of file access requested. For example, usually this means that
   the user attempted to open an ANSI magnetic tape file for write
   access, and the file has a nonzero value for buffer offset. VMS
   RMS will not allow you to create a magnetic tape file with nonzero
   buffer offset. However, you may access the file for input and
   output if you specify block I/O.

   User Action: Correct the type of access requested or change the
   attributes of the file.

IFI

invalid internal file identifier (IFI) value

   Facility: RMS, VMS Record Management Services

   Explanation: The internal file identifier field of the FAB is
   invalid. This error usually indicates that the file has not been
   opened for an operation that requires the file to be opened, or
   that the file is already opened for an operation that requires the
   file not to be opened.

   User Action: Check for a programming error. Verify the logic of
   the program to see that the file is opened or closed as required
   for the attempted operation.

IFL

index bucket fill size larger than bucket size for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The index bucket fill specified in a key definition
   XAB exceeds the bucket size for the data area.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

IFLEVLXCED

IF nesting level exceeded

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The assembler encountered more than 31 levels of
   nested conditional assembly blocks.

   User Action: Restructure the program to decrease nesting of
   conditional assembly blocks.

IFREPAGCNT

inconsistent free page count

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

IFT

illegal in footnote: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You attempted to use an illegal command between the
   DSR commands .FOOTNOTE and .ENDFOOTNOTE.

   User Action: Remove the command.

IGNCLIFLAG

line 'line-number': CLI flag ignored in this context

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an illegal argument for CLI flags for
   the current context.

   User Action: Edit the .CLI file so that all CLI flags are valid
   in the context in which they are used. Refer to the VMS Command
   Definition Utility Manual for more information on the use of
   control flags in the Command Definition Utility.

IGNFIL

ignoring input file: 'filespec'

   Facility: MONITOR, Monitor Utility

   Explanation: An input file specified in an /INPUT list was
   excluded from inclusion in a multi-file summary. The linked error
   message accompanying this message provides an explanation for the
   exclusion.

   User Action: If the ignored file is one which should be included
   in the multi-file summary, then examine the linked error message,
   correct the situation described therein, and reenter the MONITOR
   request.

IGNORED

'string' ignored

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: DSR ignored a character string during processing.

   User Action: None.

IGNORE_DIRE

directory name ignored, not used for this volume type

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility ignored the directory name field
   of a filename.

   User Action: Do not enter the directory name; it is not needed.

IGNORE_VERS

file version ignored, not used for this volume type

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility ignored the version number field
   of a filename.

   User Action: Leave the version number off; it is not needed.

IGNQUAL

qualifiers apppearing before this item were ignored

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This informational message signifies that the
   qualifiers appearing before the displayed item were ignored.

   User Action: None.

IIF

^X ignored

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A control character code (^X) was illegally entered
   in the input file and has not been accepted.

   User Action: In order to legalize the entry of such codes, you
   must enter the .CONTROL CHARACTERS command.

ILC

illegal command: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This command is illegal. Command or values you
   specify for it are unrecognizable.

   User Action: Check for spelling errors in the command keywords.

ILE

internal logic error 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR has detected an internal failure at the location
   specified by the indicated string. This is a DSR internal error.

   User Action: Submit a Software Performance Report (SPR).

ILLANSIBS

ANS magnetic tape block size must be at least 18 characters

   Facility: MOUNT, Mount Utility

   Explanation: The label specified for a magnetic tape contains less
   than 18 characters.

   User Action: Reenter the command; specify a minimum value of 18
   for the block size.

ILL_ARG

wrong number of arguments

   Facility: FDL, Create/FDL Utility

   Explanation: You specified too many files in the FDL$CREATE call.

   User Action: Specify the correct number of files.

ILLARGDESC

illegal operand argument descriptor

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The operand descriptor in an .OPDEF directive is
   invalid.

   User Action: Use one of the valid operand descriptors.

ILLASCARG

illegal ASCII argument

   Facility: MACRO, VAX MACRO Assembler

   Explanation: Either the argument to a .ASCIx directive did not
   have enclosing delimiters or an expression is not enclosed in
   angle brackets.

   User Action: Correct the syntax of the argument.

ILLBATFNC

operation not permitted while display is batched

   Facility: SMG, Screen Management Facility

   Explanation: An attempt is made to perform an operation that
   is not permitted while a virtual display is being batched-for
   example, when performing input or moving the virtual display.

   User Action: Terminate batching first by calling SMG$END_DISPLAY_
   UPDATE.

ILLBLKNUM

illegal logical block number

   Facility: SYSTEM, VMS System Services

   Explanation: The logical block number specified does not exist on
   the disk. If this error results from a Files-11 I/O operation, the
   file structure is damaged.

   User Action: Check for a programming error. If this error results
   from a Files-11 I/O operation, repair the volume with the Verify
   Utility.

ILLBRDEST

illegal branch destination

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The destination of a branch instruction is not an
   address, for example, BRB 10(R9).

   User Action: Change the destination of the branch instruction or
   use a jump (JMP) instruction.

ILLCDTST

illegal connection descriptor table state

   Facility: SYSTEM, VMS System Services

   Explanation: A system facility attempted an operation on a
   connection that is illegal for the current state of that
   connection.

   User Action: Submit a Software Performance Report (SPR).

ILLCHR

illegal character

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The source line contained a character that is illegal
   in its context.

   User Action: Delete the illegal character.

ILLCNTRFUNC

illegal ACP control function

   Facility: SYSTEM, VMS System Services

   Explanation: The control function specified in an IO$_ACPCONTROL
   QIO request is not a valid function.

   User Action: Check for a programming error. Consult the
   documentation for the correct function codes and coding
   specifications.

ILLCOMPONENT

illegal initialization component

   Facility: LIB, Library Facility

   Explanation: An illegal component value is passed to LIB$INIT_
   DATE_TIME_CONTEXT.

   User Action: Examine the component value and correct it, if
   necessary.

ILLCREOPT

illegal create options

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. Either the create options you specified for LBR$OPEN are
   illegal or no options were specified.

   User Action: Correct the create options before calling the
   routine.

ILLCTL

illegal control index

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. Either the library is not open or you have specified an
   illegal library index.

   User Action: Determine that the library is open and that the
   library index is correct.

ILLDESQUE

illegal destination queue name

   Facility: SYSTEM, VMS System Services

   Explanation: In a request to the symbiont manager, the specified
   destination queue is invalid.

   User Action: Reenter the command, specifying a valid destination
   queue.

ILLDFLTARG

illegal argument for .DEFAULT directive

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A .DEFAULT directive did not specify DISPLACEMENT
   or the displacement specified is not one of the three keywords -
   BYTE, WORD, or LONGWORD.

   User Action: Correct the .DEFAULT directive.

ILLEFC

illegal event flag cluster

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: An event flag number specified in a system service
   call is greater than 127.

   User Action: Correct the source program. Verify that the event
   flag number is correctly coded, and that it is not modified during
   the execution of the image.

ILLEGALTYPE

illegal data type

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The expression or operator contains an invalid data
   type.

   User Action: Check the data type being used and make sure that the
   expression or operator supports this data type.

ILLEVTNUM

illegal event number

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ILLEXPR

illegal expression

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A radix unary operator is not followed by a number,
   or left and right angle brackets did not match in an expression.

   User Action: Correct the syntax of the expression.

ILLFMLCN

minimum argument count ('decimal-number') exceeds maximum ('decimal-
number') in formal specification of symbol 'symbol-name' in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A procedure definition subrecord has an illegal
   format.

   User Action: Submit a Software Performance Report on the
   appropriate language compiler.

ILLFMLCNT

minimum argument count exceeds maximum for procedure 'procedure' in
module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

ILLFMT

illegal library format

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. The file you specified calling LBR$OPEN is not a
   library.

   User Action: Specify the correct library.

ILLFORMAT

illegal format, too many or not enough fields

   Facility: LIB, Library Facility

   Explanation: You entered an invalid format string.

   User Action: Examine the date/time string and correct it.

ILLFUNC

illegal library function

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. The library function you specified in LBR$OPEN is
   illegal.

   User Action: Correct the library function before calling the
   routine.

ILLIDXNUM

illegal index number

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. The index number you specified is illegal.

   User Action: Correct the index number before calling the routine.

ILLIFCOND

illegal IF condition

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The condition specified in a conditional assembly is
   not a valid condition, or there were no symbols after a DIFFERENT
   or IDENTICAL condition.

   User Action: Correct the syntax of the conditional assembly
   directive.

ILLINDXREG

invalid index register

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The base mode changed the value of the register, and
   the index register is the same as the register in the base mode;
   the base mode is literal or immediate mode; or PC is used as the
   index register.

   User Action: Correct the addressing mode.

ILLINISTR

illegal initialization string

   Facility: LIB, Library Facility

   Explanation: An incorrect initialization string is passed to
   LIB$INIT_DATE_TIME_CONTEXT.

   User Action: Verify that the initialization string begins and ends
   with the same delimiter character.

ILLINROU

input routine improperly specified or missing

   Facility: LBR, Librarian Subroutine Package

   Explanation: A librarian function is called with a missing or
   invalid input routine parameter.

   User Action: If no input routine is passed to the librarian
   function, then supply one; or check the values of the other
   arguments that were passed to ensure that none of the arguments
   specify that the input routine parameter is required. If a routine
   value is supplied, then check that it is a valid address (for
   example, nonzero).

ILLIOFUNC

illegal I/O function code

   Facility: SYSTEM, VMS System Services

   Explanation: A function code in an explicit input/output request
   is invalid. Or if the errors occurred during a DECnet-VAX
   operation, the user attempted a synchronous disconnect with
   outstanding transmits.

   User Action: Check for a programming error. Locate the invalid
   function code and correct it.

ILL_KEY

illegal key or value out of range

   Facility: CONVERT, Convert Utility

   Explanation: You have specified /KEY with a nonnumeric value, or
   with a numeric value that is outside the range of 0 to 254.

   User Action: Specify a legal value with /KEY.

ILLKEYLVL

illegal key level 'number' key 'keyname' in 'library-name' expected
'key number'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. The help module you want to insert into the library is
   formatted incorrectly.

   User Action: Reformat the module before inserting it into the
   library.

ILLMACARGN

illegal MACRO argument name

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The name in the .MACRO directive contained an illegal
   character.

   User Action: Delete the illegal character.

ILLMACNAM

illegal MACRO name

   Facility: MACRO, VAX MACRO Assembler

   Explanation: No MACRO name is specified in the .MACRO directive.

   User Action: Specify the MACRO name in the .MACRO directive.

ILLMASKBIT

reserved bits set in ENTRY mask

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The register save mask in an .ENTRY or .MASK
   directive specified R0, R1, AP, or FP registers (corresponding
   to bits 0, 1, 12, and 13).

   User Action: Remove these registers from the register save mask.

ILLMODE

illegal mode

   Facility: MACRO, VAX MACRO Assembler

   Explanation: An invalid addressing mode for the instruction is
   specified.

   User Action: Specify a legal addressing mode.

ILLMODNAM

illegal module name length 'length' for module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

ILLMTCOPY

cannot specify same magtape for both input and output

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility detected an attempt to use a
   single DOS-11 magtape for both input and output.

   User Action: Specify different magtapes for input and output, or
   copy the file onto disk before copying it back out to tape.

ILLNAMELEN

'name' 'name' name length ('decimal-number') is illegal - not 1 to
'decimal-number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The length of a psect, module, or symbol name is
   illegal.

   User Action: Correct the length and relink.

ILLOP

illegal operation for access requested

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. You have attempted to modify a Version 1.0 library or a
   read-only library.

   User Action: Compress the library into the current format or
   change the access privileges to the library file.

ILLOPDEF

illegal format for .OPDEF

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The .OPDEF directive had incorrect syntax.

   User Action: Correct the .OPDEF directive syntax.

ILLOPDEFVL

illegal value for opcode definition

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The value specified in the .OPDEF directive does not
   fit in two bytes.

   User Action: Correct the value in the directive.

ILLOPT

qualifiers not appropriate to this device

   Facility: MOUNT, Mount Utility and INIT, INITIALIZE Command

   Explanation: A DCL command MOUNT or INITIALIZE specified
   qualifiers that apply only to disk devices for a tape device,
   or qualifiers that apply only to tape devices for a disk device.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary for a list of qualifiers, and reenter the command with
   the appropriate qualifiers.

ILLOUTROU

output routine improperly specified or missing

   Facility: LBR, Librarian Subroutine Package

   Explanation: A librarian function is called with a missing or
   invalid output routine parameter.

   User Action: If no output routine is passed to the librarian
   function, either supply one or check the values of the other
   arguments that were passed. This ensures that none of the
   arguments specify that an output routine parameter is required.
   If a routine value is supplied, check to see that it is a valid
   address, for example, nonzero.

ILLPAGCNT

illegal page count parameter

   Facility: SYSTEM, VMS System Services

   Explanation: The number of pages specified for an expand or
   contract region request is less than one.

   User Action: Check for a programming error; verify the number of
   pages specified for the service call.

ILLPATAS

pattern assignment target only valid in procedure 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The target of a partial pattern assignment, the
   @ operator, was defined in, and is only valid in, the named
   procedure.

   User Action: Use a global variable for the partial pattern
   assignment or use this pattern only from within the named
   procedure.

ILLPSCLEN

psect 'psect-name' has illegal length 'length' for module 'module-
name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

ILLQUAL

invalid qualifier

   Facility: MOUNT, Mount Utility

   Explanation: An invalid qualifier is given in the command.

   User Action: Replace the qualifier and reenter the command.

ILLQUALVAL

illegal qualifier value

   Facility: LINK, Linker Utility

   Explanation: The command line contained an illegal value for a
   qualifier.

   User Action: Reenter the command correctly.

ILLRECLEN

illegal record length ('decimal-number') in module 'module-name'
file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A module contains a record of illegal length.

   User Action: Submit a Software Performance Report on the
   appropriate language compiler.

illegal record length 'length' in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).


ILLRECLN2

illegal record length 'length'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

ILLRECTY2

illegal record type 'record-type'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

ILLRECTYP

illegal record type ('decimal-number') in module 'module-name'
record 'record-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A module contains an illegal object record type.

   User Action: Submit a Software Performance Report on the
   appropriate language compiler.

illegal record type 'type' in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).


ILLREGHERE

this register may not be used here

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The PC register cannot be used in the following
   addressing modes: register, register deferred, autodecrement,
   autoincrement, and autoincrement deferred.

   User Action: Use another register.

ILLREGNUM

illegal register number

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A register name is not the AP, FP, SP, or PC register
   name. Or it is not in the range R0 through R12.

   User Action: Correct the illegal register name.

ILLREQUEST

request 'name' is invalid

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The specified request is not valid for this built-in.

   User Action: Reenter the command with a valid request string.

ILLRQST

illegal operator request

   Facility: OPCOM, Operator Communication

   Explanation: A DCL command REPLY is entered with no qualifiers.
   Or, a DCL command REQUEST specified an incorrect value.

   User Action: Verify the command line and reenter the command.

ILLSAVESET

illegal save set name specified to RESTORE_SAVESET.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product installation procedure contains an
   incorrect call to RESTORE_SAVESET.

   User Action: Contact your DIGITAL field service representative.

ILLSELF

illegal self reference

   Facility: SYSTEM, VMS System Services

   Explanation: You have unsuccessfully attempted to suspend all
   action on your own job.

   User Action: None. Your job is not suspended.

ILLSEQOP

illegal sequential operation

   Facility: SYSTEM, VMS System Services

   Explanation: When a sequential access device is used, such as a
   magnetic tape, certain operations can be performed only at the
   appropriate time. For example, the control function NEXT VOLUME
   can be executed only when the tape is positioned within the data
   section.

   User Action: Examine the source program to determine the logic
   problem.

ILLSER

illegal service call number

   Facility: SYSTEM, VMS System Services

   Explanation: An image specified an invalid change mode to
   executive or kernel service number.

   User Action: Check for a programming error. Locate the invalid
   call and correct it.

ILLSEVERITY

illegal severity of 'value' specified, error severity used

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Severities must be between 0 and 3, inclusive.

   User Action: Specify a valid severity.

ILLSHROPR

illegal shareable image reference expression operator in module
'module-name' record 'record-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An attempt is made to perform an operation, other
   than addition or subtraction, in an expression that contained a
   symbol from a shareable image.

   User Action: Correct the expression and relink.

ILLSHRXPR

illegal shareable image reference expression in module 'module-name'
record 'record-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An expression contains two symbols externally defined
   in a shareable image. The linker can resolve expressions that
   contain only one externally defined symbol.

   User Action: Correct the expression and relink.

ILLSIGEXT

illegal sign extension field value 'extension-value'

   Facility: DEBUG, VMS Debugger

   Explanation: An invalid value was entered for the sign extension
   field in a field reference.

   User Action: Reenter the command using a valid sign extension
   field value.

ILLSTRCLA

illegal string class

   Facility: STR, String Manipulation Facility

   Explanation: The class code found in the class field of a
   descriptor is not a string class code supported by the VMS
   Procedure Calling and Condition Handling Standard.

   User Action: If you are programming in a high-level language and
   using the string data types and functions that are supplied by
   the language, check that there are no logic errors where data
   is written outside array bounds or other errors where data is
   written incorrectly. If you are creating descriptors, check that
   all string descriptors are initialized before using them.

ILLSTROPS

illegal string position

   Facility: STR, String Manipulation Facility

   Explanation: Successful completion. However, one of the character-
   position parameters to a string routine pointed to a character-
   position that is before the beginning of the input string or that
   is after the end of the input string.

   User Action: Ensure that any parameter that is a character-
   position is greater than zero and less than or equal to the length
   of the input string.

ILLSTRSPE

illegal string specification

   Facility: STR, String Manipulation Facility

   Explanation: Successful completion except that the character-
   position parameters specifying a substring of a string parameter
   were inconsistent because the ending character-position is less
   than the starting character-position. A null string is used for
   the substring.

   User Action: The applications program should verify that starting
   character-positions are less than or equal to ending character-
   positions.

ILLSYMLEN

symbol 'symbol' has illegal length 'length' in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

symbol exceeds 31 characters

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The symbol name is longer than 31 characters. The
   assembler truncated the name to 31 characters.

   User Action: Specify a symbol name that has no more than 31
   characters.


ILLTIR

illegal relocation command 'command-name' in module 'module-name'
record 'record-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A module contains an invalid object language command.

   User Action: Submit a Software Performance Report on the
   appropriate language compiler.

ILLTYP

illegal library type

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. The type of library specified in LBR$INI_CONTROL is
   invalid.

   User Action: Correct the library type before calling the routine.

ILLTYPE

illegal type of operands

   Facility: DEBUG, VMS Debugger

   Explanation: The type of the operand is invalid for the operator
   specified.

   User Action: Use a valid operand.

ILLVAL

boolean value must be 0 or 1

   Facility: SMG, Screen Management Facility

   Explanation: A Boolean capability is given a value other than 0 or
   1.

   User Action: Check your terminal definitions. Boolean capabilities
   must be 0 or 1: on or off, respectively.

illegal CPU time

   Facility: RUN, Run Detached Utility

   Explanation: The CPU time limit entered with the /TIME_LIMIT
   qualifier value is too large.

   User Action: Reenter the RUN command with a valid CPU time limit.

illegal value is present

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A value is not within the valid range of values.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary, if necessary, for the valid values and reenter the
   command.



ILL_VALUE

illegal parameter value

   Facility: CONVERT, Convert Utility

   Explanation: You have specified an invalid or out-of-range value
   on a qualifier.

   User Action: Specify a valid value and try again.

ILLVEC

illegal interrupt or exception vector restart

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

ILLVECOP

illegal vector opcode fault, opcode='xx', PC='location',
PSL='xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An operation code designated as an illegal vector
   opcode by the VAX architecture has been encountered during
   the execution of an image. This message indicates an exception
   condition and is usually followed by a display of the condition
   arguments, registers, and stack at the time of the exception.

   User Action: Examine the PC of the vector instruction that
   caused the exception to be reported. (Note, however, that
   this instruction is not always the instruction that caused the
   exception.)

ILLVPS

illegal position ('decimal-number') or size ('decimal-number')
in STO_VPS command 'command-name' in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: The STO_VPS object language command has invalid
   arguments.

   User Action: Submit a Software Performance Report on the
   appropriate language compiler.

IMAGEFMT

command tables image has illegal format

   Facility: CDU, Command Definition Utility

   Explanation: Input tables have an invalid format. Either an
   invalid file is entered or a valid file is entered but then became
   corrupted.

   User Action: Do not use this file again with the SET COMMAND.

IMAGEFNF

image file not found 'filename'

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You attempted to run a nonexistent image.

   User Action: Check for typing errors and retry.

IMAGELEN

an image spec is limited to 'max-length' characters in length

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a image specification in the CLD file
   which exceeded the maximum allowable file specification character
   count. Currently file specification strings are limited to 63
   characters in length.

   User Action: Rename the image and/or use logical names to specify
   the directory of the image.

IMAGE_NOT_FOUND

this image has not yet been mapped

   Facility: IMGACT, Image Activator

   Explanation: An inconsistency exists between the shared image
   list stored in the image fixup vector and the list of global ISDs
   stored in the image header. This can possibly occur when images
   linked on older versions of VMS are run on newer versions where
   new copies of shareable images are being referenced by the old
   executable image.

   User Action: Relink the executable images to achieve a consistent
   shareable image linkage mechanism within the image header of your
   image.

IMGADDED

added image for product

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The named image file was added to the loadable image
   database for the named product.

   User Action: Verify that the named image and product are correct.

IMGBASED

shareable image 'image-name' is already based

   Facility: LINK, Linker Utility

   Explanation: You specified a base address in an options file for a
   shareable image that is already based.

   User Action: Make the image position-independent so it can be
   based anywhere; or remove the cluster option from the options file
   that tries to base it.

IMGDUPINV

image already in images table

   Facility: SMI, System Management Intergator/Server

   Explanation: The specified image name/product name pair already
   exists in the loadable image file.

   User Action: Select a different image name or product name.

IMGFILGON

loadable image file is missing

   Facility: SMI, System Management Intergator/Server

   Explanation: The loadable image database currently in use is no
   longer available.

   User Action: Check for accidental deletion of the file.

IMGFILSPE

the /IMAGE qualifier specification must have only device name

   Facility: BACKUP, Backup Utility

   Explanation: The file specification for a volume to be processed
   with the /IMAGE qualifier must contain only a device name.

   User Action: Reenter the command using the device name only.

IMGHDR

error while accessing the image header

   Facility: INSTALL, Install Utility

   Explanation: INSTALL encountered an error when trying to access
   the image header. An accompanying error message explains the
   failure.

   User Action: Correct the situation indicated by the accompanying
   error message and reenter the command.

IMGINV

image name invalid-must contain valid file name only

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The image name's file specification contains more
   than just a file name.

   User Action: Reenter the command with a valid image file name.

IMGNAME

image file 'filename'

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This message is issued with an associated message
   indicating the problem.

   User Action: Take corrective action based on the associated
   message.

IMGNOTFND

image not found for product

   Facility: SMI, System Management Intergator/Server

   Explanation: The specified image file is not found in the loadable
   image database for the given product.

   User Action: Specify a product name contained in the database.

IMGRECSIZ

invalid image record size

   Facility: MOM, Maintenance Operation Module

   Explanation: The image that is being accessed to downline load is
   unsupported.

   User Action: Use a supported image type to downline load.

IMGREMOVED

removed image for product

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The named image file was removed from the loadable
   image database for the named product.

   User Action: Verify that the named image and product are correct.

IMG_SIZ

image header descriptor length is invalid

   Facility: IMGACT, Image Activator

   Explanation: The length of the fixed part of the image header is
   invalid. This usually indicates a corrupted or invalid image.

   User Action: Relink the image.

IMGTRACED

TRACEBACK image cannot be privileged or execute_only

   Facility: INSTALL, Install Utility

   Explanation: This message indicates that an attempt is made to
   CREATE or REPLACE a known file image with either the /PRIVILEGE or
   /EXECUTE_ONLY qualifiers, and that the image had been linked with
   the /TRACEBACK qualifier.

   User Action: Relink the image using the /NOTRACEBACK qualifier and
   retry the image installation.

IMGVEXC

image exiting with pending vector exceptions

   Facility: SYSTEM, VMS System Services

   Explanation: An exception has resulted from the execution of a
   vector instruction issued by an image, however, the image exited
   before the exception could be delivered.

   User Action: The image's source code must be modified to check for
   pending vector exceptions before exiting.

   The VAX Procedure Calling and Condition Handling Standard requires
   that procedures guarantee that no exception can be raised after
   the procedure has relinquished control. If a procedure executes a
   vector instruction that might possibly raise an exception, it must
   execute a SYNC instruction (a form of MFVP instruction) prior to
   any subsequent CALL or RET.

IMX

invalid duplicate XAB or non-dense XAB at 'location'

   Facility: RMS, VMS Record Management Services

   Explanation: More than one XAB of the same type exists for
   the operation; or another XAB type occurs within a subchain of
   allocation or key definition XABs.

   User Action: The status value (STV) field of the FAB provides the
   address of the XAB in error. Verify that the call to the VMS RMS
   service is coded correctly.

Inappropriate SCA Control Message

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver closes the port-to-port virtual
   circuit to the remote port.

   User Action: Submit a Software Performance Report, including the
   error logs and the crash dumps from the local and remote systems.

IN_BARRIER_WAIT

barrier in wait state, quorum not modified

   Facility: PPL, Parallel Processing Facility

   Explanation: The barrier is already in effect at the time of this
   call.

   User Action: Recode the program to ensure that the barrier quorum
   is established before anyone attempts to wait on the barrier.

INBUILTIN

occured in built-in 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message specifies the name of the built-in that
   generated the error.

   User Action: None.

INCBADDIR

saved directory 'directory-name' has invalid format

   Facility: BACKUP, Backup Utility

   Explanation: In response to the /INCREMENTAL qualifier, the saved
   copy (in the input save set) of the specified directory is not in
   the expected format for a directory file. The file may have been
   corrupted when it is saved, or save set data may have been lost.

   User Action: After you complete the incremental restoration, check
   the files for correct format.

INCCTXT

incomplete crash context available

   Facility: SDA, System Dump Analyzer

   Explanation: A CPU that participated in the system BUGCHECK did
   not save its context information correctly. Some CPU context
   information might not be available for analysis.

   User Action: None.

INCDATTIM

incomplete date_time, missing fields with no defaults

   Facility: LIB, Library Facility

   Explanation: An incomplete date or time parameter is supplied.

   User Action: Examine the date/time string.

INCDELERR

error deleting 'filename'

   Facility: BACKUP, Backup Utility

   Explanation: An error is encountered during an attempt to delete
   the specified file in response to the /INCREMENTAL qualifier. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

INCDELETE

deleted 'filename'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility deleted the specified file in
   response to the /INCREMENTAL qualifier. This message appears if
   you specify the /LOG qualifier.

   User Action: None.

INCDEVLIS

disk and tape devices mixed in list

   Facility: BACKUP, Backup Utility

   Explanation: Disk and tape devices were mixed in a list of file
   specifications.

   User Action: Reenter the command ensuring that if a list is used,
   the devices in a list are the same type.

INCDSTNES

incorrect DST nesting in module 'path-name', compiler error

   Facility: DEBUG, VMS Debugger

   Explanation: Incorrect Debug Symbol Table nesting occurred, such
   as an invalid routine or data record nesting in the specified
   module. This message normally indicates a compiler error.

   User Action: Submit a Software Performance Report (SPR).

INCDSTQUE

inconsistent destination queue type

   Facility: JBC, Job Controller

   Explanation: The type of the specified destination queue is
   inconsistent with the requested operation.

   User Action: Specify an appropriate type of destination queue for
   the operation.

INCDUMPFORM

dump file format incompatible with this version of SDA

   Facility: SDA, System Dump Analyzer

   Explanation: You attempted to analyze a dump file taken under
   one version of the VMS operating system with an SDA image built
   against another version. The format of the dump file has changed
   between the two versions of the VMS operating system, making
   analysis impossible.

   User Action: Analyze the dump file with an SDA image built against
   the version of the VMS operating system that was running when the
   dump file was taken.

INCENTERR

error creating directory entry for 'filename'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to create a directory entry for the specified file in
   response to the /INCREMENTAL qualifier.

   User Action: Correct the condition that caused the error and
   reenter the command.

INCFILATR

incomplete file attribute data for 'filename'

   Facility: BACKUP, Backup Utility

   Explanation: There is an unexpected change in the file identifier
   and the file attribute data is incomplete for the specified file.
   BACKUP tried to restore a selected file from a save set, but the
   mounted volume did not contain the beginning of the file.

   User Action: Retry the BACKUP operation using the volume which
   contains the beginning of the selected file as input.

INCFILSPE

the /INCREMENTAL qualifier specification must have only device name

   Facility: BACKUP, Backup Utility

   Explanation: The file specification for a volume to be processed
   with the /INCREMENTAL qualifier must contain only a device name.

   User Action: Reenter the command using only the device name.

INCFORMPAR

inconsistent form parameters

   Facility: JBC, Job Controller

   Explanation: The specified length, width, and margin parameters
   are inconsistent. The sum of the top and bottom margins must be
   less than the length, and the sum of the left and right margins
   must be less than the width.

   User Action: Correct the incorrect form parameters.

INCHMK

inhibited CHMKernel trap

   Facility: SYSTEM, VMS System Services

   Explanation: An applications program attempted a system service
   that is inhibited to it.

   User Action: Ask the system manager which system services are
   currently inhibited and remove them from the program.

INCKWDCOM

inconsistent keyword combination

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The specified keyword combination is inconsistent.

   User Action: Specify a consistent set of keywords.

Include file could not be closed

   Facility: EDT, EDT Editor

   Explanation: You specified the name of a file that EDT could not
   close while using the INCLUDE command. Some problem exists at the
   system level that prevents EDT from closing the file.

   User Action: After determining what system problem prevents EDT
   from closing the file, correct it.

Include file could not be opened

   Facility: EDT, EDT Editor

   Explanation: You specified the name of a file that EDT could not
   open while using the INCLUDE command. Some problem exists at the
   system level that prevents EDT from opening the file.

   User Action: After determining what system problem prevents EDT
   from opening the file, correct it.

Include file does not exist

   Facility: EDT, EDT Editor

   Explanation: You typed a file specification with the INCLUDE
   command for a file that does not exist. The file might exist in
   a directory other than the one you specified or implied with the
   command. Or you might have made a typographical error in the file
   specification.

   User Action: Enter the correct include file specification.

Include file input record too large, truncated to 255 characters

   Facility: EDT, EDT Editor

   Explanation: EDT can handle only 255 characters on a line. The
   file you want to include has one or more lines in it that exceed
   255 characters. EDT truncates the line to be only 255 characters
   long.

   User Action: None.

INCMEMNAM

specified shared memory name does not match

   Facility: SYSGEN, System Generation Utility

   Explanation: The logical name assigned to the shared memory by the
   SYSGEN command SHARE does not match the name in the database of
   shared memory that is specified previously.

   User Action: Reenter the command with the correct name.

INCMVE

incompatible management version

   Facility: NCP, Network Control Program

   Explanation: The requested function cannot be performed
   because the software versions at the command source and command
   destination are incompatible.

   User Action: None. The software at the command destination must be
   updated for the command to succeed.

INCOMPACP

indicated ACP is incompatible with 'volume'

   Facility: MOUNT, Mount Utility

   Explanation: The ACP specified is not an ACP for the requested
   device.

   User Action: Reenter the command; specify an ACP that is
   appropriate for the particular device type.

INCOMPAT

'input-filespec' (input) and 'output-filespec' (output) have
incompatible attributes

   Facility: Shared by several facilities

   Explanation: This warning message indicates that file
   incompatibility may exist between files that have been appended or
   concatenated. This message can occur if files created by different
   methods are concatenated, for example, files created with the DCL
   command WRITE and files created by the DCL command SORT/RSX11. The
   command continues execution.

   User Action: Determine whether the incompatibility presents a
   problem and if it does, delete the output files, modify the format
   of one or more input files, and reenter the command.

   The format of a file can be modified by editing the file with the
   SOS or SLP editors and creating a new version of the file.

feature incompatible with previous system version

   Facility: SYSTEM, VMS System Services

   Explanation: This alternate success status indicates that the
   function requested is not compatible with the version of the
   I/O driver in use. This error message typically occurs when a
   remote terminal link is used between different versions of VMS.
   For example, it could indicate that the function requested by
   the newest VMS Version 3.0 is not implemented on the previous VMS
   Version 2.5.

   User Action: Upgrade systems using remote terminals so that they
   use the same version of the operating system.

qualifiers incompatible with already mounted volume

   Facility: MOUNT, Mount Utility

   Explanation: A DCL command MOUNT is entered to mount a shareable
   volume that is already mounted; the characteristics of the volume
   are already established and cannot be changed.

   User Action: Use the DCL command SHOW DEVICE to determine how the
   volume is mounted. Reenter the DCL command MOUNT/SHARE without
   qualifiers.



INCOMPEXI

incompatible element with the same name already exists

   Facility: PPL, Parallel Processing Facility

   Explanation: All PPL objects must have unique names.

   User Action: Recode the call to specify a unique name.

INCOMPL

'LMB-name' not completely written in the dump file

   Facility: SDA, System Dump Analyzer

   Explanation: Information corresponding to a Logical Memory Block
   (LMB) is saved only partially in this subsetted dump file. The
   dump file may or may not be useful for analysis, depending on
   which LMB was only partially saved. If the SDA image retains
   control after the error, then some analysis is possible, but some
   information may not be available in the dump file.

   User Action: None. The dump file might not be useful for analysis.

INCOMPLETE

previous incomplete operation prevents execution

   Facility: JBC, Job Controller

   Explanation: The requested queue management operation cannot be
   executed because a previously requested queue management operation
   has not yet completed.

   User Action: Retry the operation at a later time. For a queue-
   related operation, it may be necessary to enter the STOP/QUEUE
   /RESET command if this error condition persists. However, for
   a STOP/QUEUE/MANAGER request (which may take a long time to
   complete), you need to wait until the request is completed.

INCOMPSHR

incompatible sharing requested

   Facility: RMS, VMS Record Management Services

   Explanation: File currently being shared is using an incompatible
   sharing protocol. This may occur in a mixed version cluster
   environment.

   User Action: The file being opened must be deaccessed by all
   current accessors using the incompatible sharing protocol to allow
   changing of the sharing protocol. All applications attempting to
   simultaneously access a file must use compatible sharing.

INCONISD

inconsistent ISD structures detected

   Facility: IMGACT, Image Activator

   Explanation: Either an image section descriptor is found to cross
   an image header block boundary, or there is an indication that an
   ISD would be found in the next header block and there is no such
   ISD. This usually indicates a corrupted or invalid image.

   User Action: Relink the image.

INCONQUALS

qualifier /'qualifier' contradicts qualifier /'qualifier'

   Facility: BACKUP, Backup Utility

   Explanation: The two qualifiers specified are in conflict with one
   another and cannot be used together in the BACKUP command.

   User Action: Reenter the BACKUP command with only one of the two
   qualifiers. For more information on how qualifiers affect the
   BACKUP command, see the VMS Backup Utility Manual.

INCONSDEV

inconsistent device types

   Facility: MOUNT, Mount Utility

   Explanation: Both disks and magnetic tapes appear in the list of
   devices to be mounted.

   User Action: Specify one or the other and reenter the command;
   check the logical name assignments.

INCONSTATE

inconsistent UBA database

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

internal consistency state; please submit an SPR with
SYS$SYSROOT:[SYSEXE]AUDIT_SERVER.DMP

   Facility: AUDSRV, Audit Server

   Explanation: An internal consistency error has occurred in the
   audit server process.

   User Action: Please submit a Software Performance Report (SPR)
   and include the process dump file SYS$SYSROOT:[SYSEXE]AUDIT_
   SERVER.DMP, if one exists.


INCPTREF

increment page table reference count error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INCQUETYP

inconsistent queue type

   Facility: JBC, Job Controller

   Explanation: The type of the specified queue is inconsistent with
   the requested operation.

   User Action: Specify an appropriate type of queue for the
   operation.

INCQUOTA

QUOTA.SYS indicates 'n' blocks used, actual use is 'n' blocks for
['uic']

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the disk usage for the
   specified UIC, as recorded in the quota file, did not agree with
   the actual disk usage.

   User Action: None. The utility corrects the quota file.

INCRVN

incorrect relative volume mounted on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: Either the wrong volume of a multivolume disk save-
   set was mounted, or the positional order of the devices in the
   input specification does not agree with the relative volume
   numbers recorded on the volumes.

   User Action: Locate and mount the correct volume.

INCSEGTRA

incomplete segmented transfer request posted

   Facility: SYSTEM, VMS System Services

   Explanation: A driver returned a success status but failed to
   complete the current segment of a segmented transfer.

   User Action: If this error can be reliably reproduced, the
   media and program producing the error should be submitted with
   a Software Performance Report (SPR).

INCSETCNT

incorrect number of devices in input specification

   Facility: BACKUP, Backup Utility

   Explanation: The number of devices in the input specification does
   not agree with the volume set count recorded on relative volume 1.

   User Action: Reenter the command with the correct number of
   devices.

INCVOLLABEL

incorrect volume label

   Facility: SYSTEM, VMS System Services

   Explanation: The label specified does not match the label on the
   volume.

   User Action: Verify that the correct volume is mounted; verify the
   label entered. Repeat the request specifying the correct volume
   label or specifying OVERRIDE:ID, which requires either that you
   have the volume protection privilege or that you are the volume
   owner.

INDEX

invalid index file position

   Facility: INIT, INITIALIZE Command

   Explanation: The block specified for the position of the index
   file for a disk volume is larger than the number of blocks on the
   disk. The DCL command INITIALIZE cannot write the index file.

   User Action: Reenter the command; specify a position for the index
   file that is within the range of blocks on the volume.

INDEXERR

index error in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: Possible causes of the error are:

   o  An error occurred while searching or traversing the index

   o  A VMS RMS error occurred

   o  Not enough virtual memory is available

   User Action: Compress the library before reentering the command
   string.

INDEXOVFL

index area overflow in section-please submit SPR

   Facility: MESSAGE, Message Utility

   Explanation: An internal error in the compiler was detected.

   User Action: Submit a Software Performance Report (SPR).

INDEXTYPE

array index data type, 'type', unsupported

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The data type of the array index is not supported.

   User Action: Use only integers for array indexing.

IND_OVR

indexed output file must already exist

   Facility: SORT, Sort/Merge Utility

   Explanation: You specified indexed output file organization, but
   the file did not already exist.

   User Action: First create the indexed file with the RMS Define
   Utility. The primary key of the file should be the same as the
   sort key for efficiency, but is not required.

INHCHME

inhibited CHMExecutive trap

   Facility: SYSTEM, VMS System Services

   Explanation: An applications program attempted a system service
   that is inhibited to it.

   User Action: Ask the system manager which system services are
   currently inhibited and remove them from the program.

INI

improperly nested: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: Your conditional DSR commands (.IF/.IFNOT and .ELSE
   /.ENDIF) are improperly matched.

   User Action: Correct the DSR commands so they match.

INIACC

failed to access initialization file

   Facility: REM, Set Host Facility

   Explanation: An error occurred in opening the initialization file.
   This message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

INIERR

error writing to initialization file

   Facility: REM, Set Host Facility

   Explanation: An error occurred in writing to an initialization
   file. This message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

INITERR

error initializing 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: An error occurred initializing the specified library.
   This message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

error initializing 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: There is insufficient virtual memory available.

   User Action: Ask the system manager to increase your page file
   quota or VIRTUALPAGECNT.


INITIAL

language is 'language-name', module set to 'path-name'

   Facility: DEBUG, VMS Debugger

   Explanation: This message is displayed when the debugger is
   invoked by the image activator. The language is set to 'language-
   name', and the module to 'path-name'. Module 'path-name' is
   the first module specified in the LINK command, and language
   'language-name' is the language used in that module.

   User Action: None.

INITPRS

error code of 'xx' on command line parse init

   Facility: PATCH, Patch Utility

   Explanation: A CLI callback failure occurred due to the error
   represented as xx.

   User Action: Submit a Software Performance Report (SPR).

INM

illegal number value: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The parameter value is too large, too small, invalid,
   or not a number.

   User Action: Check to see that the value is formatted properly.

INOVNORCV

expected integer overflow exception not received

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error while testing a vector processor's ability to
   generate arithmetic exceptions.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

INPBUFOVR

input buffer overflow is detected

   Facility: DTK, DECtalk Facility

   Explanation: An input buffer overflow malfunction occurred after
   the DECtalk device was turned on.

   User Action: Check the DECtalk hardware.

INPCONERR

input conversion error

   Facility: OTS, General Purpose Facility

   Explanation: There is an invalid character in the input string. Or
   the output value is not within the range of destination data type.

   User Action: Correct the input string or change the destination
   data type.

INP_FILES

too many input files

   Facility: CONVERT, Convert Utility

   Explanation: You listed more than 10 input files.

   User Action: Reduce the number of input files or combine them so
   that you list no more than 10.

too many input files specified

   Facility: SORT, Sort/Merge Utility

   Explanation: You listed more than 10 input files.

   User Action: Reduce the number of input files or combine them so
   that you list no more than 10.


INPSTRTRU

input string truncated

   Facility: LIB, Library Facility

   Explanation: An input string accepted by LIB$GET_INPUT was
   truncated to fit the string descriptor passed to it. This message
   is associated with a status code returned from a Run-Time Library
   procedure and is not normally displayed by the operating system.

   User Action: Correct your program by increasing the field length
   in the descriptor.

INPTOOLON

input string is too long

   Facility: SMG, Screen Management Facility

   Explanation: The length of an input string exceeded 255
   characters.

   User Action: Shorten the string to fewer than 255 characters.

INPUT

'filename', 'n' selected, 'n' rejected, 'n' skipped

   Facility: ERF, Error Log Utility

   Explanation: This message reports the input file name and the
   number of entries selected, rejected, or skipped from the input
   file.

   User Action: None.

'filespec', 'n-records' selected, 'n-records ' rejected

   Facility: ACCOUNTING, Accounting Utility

   Explanation: This informational message is displayed when the /LOG
   qualifier is used. It describes how many records were selected
   and/or rejected for each input file.

   User Action: None.

Input file could not be closed

   Facility: EDT, EDT Editor

   Explanation: EDT could not close the input file that you named
   in your EDIT/EDT command line or in the line mode INCLUDE command
   line. Some problem exists at the system level that prevents EDT
   from closing the file.

   User Action: After determining what system problem prevents EDT
   from closing the file, correct it.

Input file could not be opened

   Facility: EDT, EDT Editor

   Explanation: Either the command contains faulty syntax or a
   nonexistent directory is specified.

   User Action: Check your command syntax. Ensure that any directory
   specified exists. Reenter the command using the correct syntax.

Input file does not exist

   Facility: EDT, EDT Editor

   Explanation: The input file is not contained in the specified
   directory. When you are creating a new file using the EDT editor,
   this message is displayed indicating the creation of a new file.

   User Action: No action is necessary if you are creating a file. If
   you are editing an existing file, ensure that you have typed the
   file specification correctly and reenter the command.

Input file does not have standard text file format

   Facility: EDT, EDT Editor

   Explanation: You edited a file that does not have standard file
   attributes (for example, a file that does not have carriage
   returns at the ends of lines).

   User Action: This message is only a warning. EDT allows you to
   edit the file, but be aware that difficulties can arise if you
   attempt to edit the nonstandard elements.

Input record too large, truncated to 255 characters

   Facility: EDT, EDT Editor

   Explanation: A record in the input file exceeds 255 characters.

   User Action: Modify the record in the input file to contain 255
   characters or less. This message can also occur due to an attempt
   to edit a file that does not contain ASCII text.


INPUT_CANCELED

input request canceled

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Terminal input indicates that the input request was
   canceled.

   User Action: None. This is an internal status.

INPUTERR

error opening primary input file SYS$INPUT

   Facility: LOGIN, Login Processor

   Explanation: An error occurred while trying to open SYS$INPUT. An
   accompanying message will provide more information.

   User Action: Correct the problem described by the accompanying
   message, and try again.

INSCLIMEM

insufficient CLI memory

   Facility: LIB, Library Facility

   Explanation: The CLI could not obtain enough virtual memory
   to perform the function. This may be caused by having too many
   symbols defined.

   User Action: Delete some symbol definitions. Then retry the
   operation.

INSCOLL

not enough collections for summary processing

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during summary processing. For
   summary processing to take place, at least two collections must be
   completed.

   User Action: This error may occur if you interrupt (by typing
   CTRL/C) a summary request before the second collection has been
   completed. Reenter your command and allow at least two collections
   to be completed.

INSDFAIL

the installation of a product has failed.

   Facility: VMSINSTAL, Install Procedures

   Explanation: An error occurred in an attempt to defer callbacks
   during the installation.

   User Action: Examine the console output to determine the cause of
   the error. If you are unable to resolve the problem, contact your
   DIGITAL field service representative.

INSEF

insufficient event flag

   Facility: LIB, Library Facility

   Explanation: A call is made to LIB$GET_EF to allocate an event
   flag number, but all event flag numbers were unavailable.

   User Action: Use LIB$FREE_EF to free previously allocated event
   flag numbers if they are no longer being used.

INSERTED

module 'module-name' inserted in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This success message is generated by the DCL command
   LIBRARY. This message is informational.

   User Action: None.

INSERTERR

error inserting 'module-name' in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. One of the following conditions prevented the DCL command
   LIBRARY from inserting the specified modules into the library:

   o  The modules are not formatted correctly.

   o  The organization of the input file is incorrect.

   o  A VMS RMS error has occurred.

   o  There is not enough virtual memory.

   User Action: Correct the error and insert the file.

INSFAIL

the installation of 'product-name' has failed.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The installation failed.

   User Action: Examine the console output to determine the cause of
   the error. If you are unable to resolve the problem, contact your
   DIGITAL field service representative.

INSFANL

insufficient data in Definition and/or Analysis files

   Facility: FDL, Edit/FDL Utility

   Explanation: EDIT/FDL is executing an optimize script invoked by
   the /NOINTERACTIVE qualifier. Certain information about the file
   is missing from the definition or the analysis file.

   User Action: Supply the missing information by reexecuting the
   ANALYZE/RMS_FILE/FDL command to produce another analysis file and
   /or use the analysis file as the definition file.

INSFARG

insufficient call arguments

   Facility: SYSTEM, VMS System Services

   Explanation: A system service argument list contained fewer than
   the required number of arguments for the service.

   User Action: Check for a programming error. Refer to the VMS
   System Services Reference Manual for coding specifications.

INSFBUFDP

unable to allocate a buffered datapath

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with a status code
   returned from a request to an LPA11-K interface device. A UBA-
   buffered data path is not available for allocation.

   User Action: Rerun the program.

INSFCDT

insufficient CDT entries

   Facility: SYSTEM, VMS System Services

   Explanation: There is currently an insufficient number of
   connection descriptor table entries for completing a request.

   User Action: Attempt your request at a later time.

INSFMAPREG

insufficient map registers

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with a status code
   returned from a request to an LPA11-K interface device to
   initialize the LPA11-K or start data transfer. Insufficient UNIBUS
   adapter (UBA) map registers are available to map the command table
   or buffer areas.

   User Action: If the map registers were preallocated when the drive
   is loaded, increase the preallocation.

INSFMEM

insufficient dynamic memory

   Facility: SYSGEN, System Generation Utility

   Explanation: There is not enough room in the nonpaged pool to
   load a driver or create a control block for it. If this message
   is associated with a vector disabled (VECDIS) status code, the
   current process has issued a vector instruction, but insufficient
   system nonpaged dynamic memory exists to establish the process as
   a vector consumer.

   User Action: Reboot the system, stopping in SYSBOOT, and increase
   the value of the parameter NPAGEDYN.

insufficient dynamic memory

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: A command or image exhausted the system pool of
   available dynamic memory and the system cannot complete the
   request.

   Or, the system manager did not allocate enough dynamic memory.

   User Action: Check for a programming error; this status code
   can be returned from a system service request when the image
   has disabled resource wait mode. Notify the system manager if
   insufficient memory is allocated.

insufficient good memory to continue

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: Too little memory on the satellite is available for
   bootstrap execution.

   User Action: Check that the configuration matches the minimum
   guidelines in the Software Product Description (SPD). If they do
   not match, add more memory. Run diagnostics on memory to verify
   that all the system memory is functional.



INSFPRM

missing command parameters-supply all required parameters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command cannot be executed because one or more
   required parameters are missing from the command. With the DCL
   command interpreter, this message occurs only during the execution
   of command procedures; at the interactive level, the command
   interpreter continues to prompt until all required parameters
   are entered.

   User Action: Correct the command procedure.

INSFRAME

insufficient call frames to unwind

   Facility: SYSTEM, VMS System Services

   Explanation: An unwind request specified a depth that is greater
   than the number of call frames on the stack.

   User Action: Check for a programming error.

INSFSPTS

insufficient SPTs to map process buffer to system

   Facility: SYSTEM, VMS System Services

   Explanation: There are insufficient system page table entries to
   map a process buffer to the system.

   User Action: Reboot the system and increase the SYSGEN parameter
   SPTREQ.

INSFVM

unable to obtain virtual memory

   Facility: EVL, Event Logger

   Explanation: A program or system configuration problem exhausted
   virtual memory.

   User Action: Check the value of the VIRTUALPAGECNT using SYSGEN.
   If the value is 2048 or greater, then this message indicates a
   program problem.

INSFWSL

insufficient working set limit

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: A command or image cannot execute because the current
   working set limit for the process is less than the number of pages
   that must be resident in memory at the same time for an image to
   execute.

   User Action: Check for a programming error; verify that the number
   of pages requested in a system service request is accurate. If
   the number of pages is accurate, try to increase the size of the
   working set limit with the DCL command SET WORKING_SET and retry
   the program. If this message is associated with a vector disabled
   (VECDIS) status code, the process's current working set list limit
   does not allow its mainline vector state to be resident in memory.

INSKIPPED

unreasonable instruction stream-'n' bytes skipped

   Facility: SDA, System Dump Analyzer

   Explanation: SDA cannot decode a range of memory locations into
   VAX MACRO instruction format because the locations do not begin on
   an instruction boundary.

   User Action: None. SDA ignores the bytes it cannot translate.

INSLUN

insufficient logical unit numbers

   Facility: LIB, Library Facility

   Explanation: A call is made to LIB$GET_LUN to allocate a logical
   unit number, but all logical unit numbers were unavailable.

   User Action: Use LIB$FREE_LUN to free previously allocated logical
   unit numbers if they are no longer used.

INSNFREPAG

insufficient nonfree pages

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INSOPRND

missing instruction operand

   Facility: PATCH, Patch Utility

   Explanation: One or more operands were omitted from the
   instruction.

   User Action: Add the required number of operands and retry the
   operation.

INSQUOCRE

insufficient quota to create a subprocess

   Facility: SMG, Screen Management Facility

   Explanation: The current BYTLM or PRCLM quota value is too small
   to create a subprocess.

   User Action: Increase the BYTLM or the PRCLM quota value, or both.

INSSWPFIL

insufficient swap file space

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

Insufficient memory

   Facility: EDT, EDT Editor

   Explanation: There is insufficient memory to complete the last
   command. This message can occur when you define a new text buffer
   or use the EDT command DEFINE KEY.

   User Action: Exit from EDT and restart your editing session.
   To avoid this problem in the future, define fewer keys and text
   buffers or decrease the size of the text buffers.

Insufficient Non-paged Pool for Initialization

   Facility: VAXport, VAXport Driver

   Explanation: The port driver will not attempt to start the port.

   User Action: Increase the NPAGEDYN pool SYSGEN parameter and
   reboot the system.

Insufficient Non-paged Pool for Virtual Circuits

   Facility: VAXport, VAXport Driver

   Explanation: After finding that insufficient memory resources
   are available for normal communication, the port driver breaks a
   virtual circuit.

   User Action: Increase the NPAGEDYN pool SYSGEN parameter and
   reboot the system.

INSUFFMEM

dump file contains less than 512K of memory

   Facility: SDA, System Dump Analyzer

   Explanation: The information in the first block of the dump file
   indicates that less than 512K of memory information was saved in
   the dump file. The dump file contents are assumed to be invalid,
   since all the VMS operating systems require more than 512K of
   memory to boot.

   User Action: None. The dump file is not useful for analysis.

INSUFPAT

'nn' bytes requested, patch area at 'addr' contains 'nn' bytes

   Facility: PATCH, Patch Utility

   Explanation: The user-defined patch area is not large enough to
   accommodate the specified code.

   User Action: Use an alternate patch area, for example, the default
   patch area. Generally, the default patch area is expandable.

INSVIRMEM

insufficient virtual memory

   Facility: STR, String Manipulation Facility

   Explanation: An attempt is made to allocate heap storage for use
   as dynamic strings, or string temporaries failed.

   User Action: If you allocate space by calling STR$GET1_DX or
   LIB$GET_VM, verify, when you finish using the storage, that
   the storage is released by calling STR$FREE1_DX or LIB$FREE_VM,
   respectively. If you are using a high-level language and have not
   directly allocated space, you can cause this error by having a
   large number of long strings. In this case, make sure to reduce
   strings to zero length when they are not in use.

insufficient virtual memory available

   Facility: FDL, Create/FDL Utility

   Explanation: insufficient virtual memory available for parsing a
   complex FDL file.

   User Action: Reduce the complexity of the FDL file or have the
   system manager increase the available virtual memory. If this does
   not solve the problem, submit a Software Performance Report (SPR)
   and include the FDL file.

insufficient virtual memory

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An attempt to allocate additional memory for working
   storage failed.

   User Action: Purge or delete files to free space in memory.

insufficient virtual memory available

   Facility: PPL, Parallel Processing Facility

   Explanation: The calling service does not have sufficient
   available space to complete the request.

   User Action: If you use extensive PPL services, try specifying
   a larger value to PPL$INITIALIZE. Otherwise, check your system
   quotas to see if more space is needed.

insufficient virtual memory-DIF aborted

   Facility: DIFF, DIFFERENCES Command

   Explanation: The Differences Utility has run out of virtual memory
   for one of the following reasons: (1) the Differences Utility
   encountered a difference section that contains more records than
   can be stored in virtual memory, or (2) the Differences Utility
   ran out of virtual memory while storing records away to be used
   while generating additional listings.

   User Action: In the first case, cut down the size of the offending
   difference section; the listing will have terminated in the middle
   of the section. You can do this by increasing the value of the
   /WINDOW parameter if it is not being defaulted.

   In the second case, rerun the Differences Utility and generate one
   listing at a time.

insufficient virtual memory for 'number' pages for cluster 'cluster-
name'

   Facility: LINK, Linker Utility

   Explanation: The linker could not allocate enough virtual memory
   in the resulting image to contain a cluster.

   User Action: Determine why the linker ran out of virtual memory by
   consulting a /FULL map, correct, and relink.

insufficient virtual memory (See also the following messages)

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The module being assembled has too many symbols and
   macro definitions for the virtual memory available or a macro
   definition called itself (a recursive definition). The assembler
   terminated the assembly.

   User Action: Increase the virtual memory available by contacting
   the system manager; reduce the level of macro nesting; split the
   module into several smaller modules; or eliminate the recursive
   macro definition.







INSWAPERR

inswap read error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INTDATCOR

internal data corrupted in run-time library

   Facility: OTS, General Purpose Facility

   Explanation: In a call to the Run-Time Library, a database
   consistency check failed. An applications program can cause this
   by referring to a location outside a dimensioned array, or by
   requesting input from an address outside the program.

   User Action: Recompile any module that you think may refer outside
   a dimensioned array with the /CHECK=BOUNDS qualifier. Relink and
   rerun your program.

INTDELPRC

participant stopped by PPL$STOP

   Facility: PPL, Parallel Processing Facility

   Explanation: An application call to PPL$STOP forced the
   termination of this participant.

   User Action: Since the application itself terminated this party,
   any actions are application-dependent.

INTDIV

arithmetic trap, integer divide by zero at PC = 'xxxxxxxx', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An arithmetic exception condition occurred as a
   result of an attempt to divide by zero.

   User Action: Examine the PC location displayed in the message and
   check the program listing to verify that operands and variables
   are specified correctly.

INTEGER

please enter an integer value.

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL is prompting you for an integer.

   User Action: Specify an integer.

INTERLOCK

unable to acquire system data structure interlock

   Facility: SYSTEM, VMS System Services

   Explanation: The system data structure interlock cannot be
   acquired. Another processor probably crashed while holding a data
   structure lock.

   User Action: Retry the operation, or reboot the system and
   reinitialize shared memory. Refer to the Guide to Maintaining
   a VMS System.

INTERNAL

LATCP internal error

   Facility: LATCP, LAT Control Program

   Explanation: LATCP or the LAT port driver has insufficient buffer
   space or has detected an internal error.

   User Action: Verify that you entered the correct command. If the
   problem persists, submit a Software Performance Report (SPR).

Internal software error-please submit a Software Performance Report

   Facility: Shared by several facilities

   Explanation: A problem exists with the software as installed on
   your system.

   User Action: Submit a Software Performance Report (SPR).

INTERR

internal debugger error in 'debug-routine-name'

   Facility: DEBUG, VMS Debugger

   Explanation: An internal debugger error has been encountered.

   User Action: If the error is reproducible, submit a Software
   Performance Report and, if possible, enclose both a copy of
   the program being debugged and a logged debugging session that
   reproduces the error.

internal logic error

   Facility: REM, Set Host Facility

   Explanation: A violation of CTERM protocol occurred.

   User Action: Submit a Software Performance Report.


INTHCHAR

internal error: encountered character of class h-string

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a corrupted internal data structure.

   User Action: Submit a Software Performance Report (SPR). Include
   the CLD file in the Report (SPR).

INTINVNODE

internal error: invalid node encountered

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a corrupted internal data structure.

   User Action: Submit a Software Performance Report (SPR). Include
   the CLD file in the Report (SPR).

INTLOGERR

internal logic error

   Facility: LIB, Library Facility

   Explanation: A LIB$ routine detected an internal logic error.
   This message is associated with a status code returned from the
   Run-Time Library.

   User Action: Submit a Software Performance Report (SPR).

INTMEMERR

internal memory-pool error

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger's internal memory area is corrupted or
   is inconsistent. This can be caused by an internal debugger error
   or by random stores by the application program.

   User Action: Remove random stores from the application program or
   submit a Software Performance Report (SPR).

INTNODESPACE

internal error: node space exhausted

   Facility: CDU, Command Definition Utility

   Explanation: CDU exhausted internal memory.

   User Action: Submit a Software Performance Report including the
   CLD file.

INTOVF

arithmetic trap, integer overflow at PC = 'xxxxxxxx', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An exception condition occurred as a result of an
   integer overflow.

   User Action: Examine the PC location displayed in the message and
   check the program listing to verify that operands or variables are
   specified correctly.

integer overflow

   Facility: LIB, Library Facility

   Explanation: Either the library routine or the hardware detected
   an integer overflow.

   User Action: Choose a destination data type with a larger range.


INTPATHSTKOV

internal error: path stack overflow

   Facility: CDU, Command Definition Utility

   Explanation: CDU exhausted internal memory.

   User Action: Submit a Software Performance Report including the
   CLD file.

INTRNLERR

internal error: 'code'

   Facility: INSTALL, Install Utility

   Explanation: INSTALL encountered an internal error.

   User Action: Submit a Software Performance Report (SPR).

LBR internal error. Please submit SPR.

   Facility: LBR, Librarian Subroutine Package

   Explanation: This is an internal consistency check.

   User Action: Submit a Software Performance Report that includes
   relevant files wherever possible.


INTSTKOV

linker internal stack of 'number' overflowed in module 'module-name'
file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The linker's internal stack overflowed because of a
   complex calculation.

   User Action: Submit a Software Performance Report (SPR).

INTSTKUN

linker internal stack of 'number' underflowed in module 'module-
name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module attempted to remove more items from
   the stack than it pushed on it.

   User Action: Submit a Software Performance Report on the
   appropriate language compiler.

INTTERMIN

participant stopped by PPL$TERMINATE

   Facility: PPL, Parallel Processing Facility

   Explanation: An application call to PPL$TERMINATE forced the
   temination of this participant.

   User Action: Since the application itself terminated this party,
   any actions are application-dependent.

INVACC

invalid access control specified for the executor

   Facility: NCP, Network Control Program

   Explanation: You specified invalid or conflicting access control
   information for connecting to an executor node.

   User Action: Confirm that the access control specified is correct.
   Use either the standard VMS access control format (node-spec) or
   the NCP-specific format (USER, ACCOUNT, PASSWORD), but do not use
   both.

INVACCESS

error in access specification

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The access specification contains a syntax error.

   User Action: Correct the syntax and reenter the access
   specification.

invalid file access specified

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU error occurred.

   User Action: Submit a Software Performance Report (SPR).


INVACCREC

record 'record' has invalid or unrecognized format

   Facility: ACCOUNTING, Accounting Utility

   Explanation: A record in the accounting file has an invalid
   or unrecognized format. The ACCOUNTING Utility will attempt to
   continue processing records.

   User Action: Examine the accounting file and verify that it is
   a valid VMS accounting file. Check for hardware errors. Submit a
   Software Performance Report with the accounting file in question,
   if the problem persists.

INVADAP

invalid adapter name specified

   Facility: SYSGEN, System Generation Utility

   Explanation: The specified adapter number is found to be invalid
   after bootstrap.

   User Action: Reenter the command using the correct adapter number.

Invalid buffer name

   Facility: EDT, EDT Editor

   Explanation: Invalid syntax is used for the buffer name in the EDT
   command.

   User Action: Reenter the EDT command specifying valid syntax for
   the buffer name.

Invalid character

   Facility: EDT, EDT Editor

   Explanation: You attempted to insert a character by using the
   SPECINS function or ASC command, but did not supply a valid
   decimal equivalent for the character.

   User Action: Reenter the command specifying a valid decimal
   equivalent for the character.

Invalid entity

   Facility: EDT, EDT Editor

   Explanation: The entity portion of the EDT change mode command is
   not recognized.

   User Action: Reenter the EDT change mode command specifying a
   valid entity.

Invalid option for that command

   Facility: EDT, EDT Editor

   Explanation: The /OPTION qualifier is specified for an EDT command
   that does not accept the /OPTION qualifier.

   User Action: Reenter the EDT command without specifying the
   /OPTION qualifier.

Invalid parameter for SET or SHOW

   Facility: EDT, EDT Editor

   Explanation: The EDT commands SET and SHOW do not accept one of
   the parameters you specified.

   User Action: Reenter the EDT command specifying a valid parameter.

Invalid string

   Facility: EDT, EDT Editor

   Explanation: You specified a string that EDT could not handle. For
   example, this message occurs when you use a search string longer
   than 64 characters.

   User Action: Reenter the command specifying a valid string.

Invalid subcommand

   Facility: EDT, EDT Editor

   Explanation: You have used an improper name for an EDT change mode
   subcommand.

   User Action: Use a valid name. For a list of the EDT change mode
   subcommands, type HELP CHANGE SUBCOMMANDS in line mode.

Invalid value in SET command

   Facility: EDT, EDT Editor

   Explanation: The EDT command SET has an invalid keyword.

   User Action: Reenter the command specifying a valid keyword.

INVALIGN

invalid alignment

   Facility: MACRO, VAX MACRO Assembler

   Explanation: An unrecognized keyword or no integer or no keyword
   followed the .ALIGN directive.

   User Action: Correct the syntax of the .ALIGN directive.

INVALQUAL

the 'qualifier-name' is an invalid qualifier in this context

   Facility: BAD, Bad Block Locator Utility

   Explanation: The qualifier indicated is issued in an invalid
   context.

   User Action: Consult the documentation for the list of valid,
   nonconflicting qualifier specifications and usage in various
   analysis contexts.

INVARG

invalid argument

   Facility: DCX, Data Compression/Expansion Utility

   Explanation: A DCX procedure has been called with an incorrect
   argument.

   User Action: Correct the application program.

invalid argument

   Facility: DTK, DECtalk Facility

   Explanation: The value of an argument is not in the correct range.

   User Action: Examine each argument. Determine which one is out of
   range, and correct your program.

invalid argument

   Facility: PPL, Parallel Processing Facility

   Explanation: A specified argument is invalid.

   User Action: Recode the program to pass a valid argument.

invalid argument

   Facility: SMG, Screen Management Facility

   Explanation: The value of some argument is not in the correct
   range.

   User Action: Examine each argument. Determine which one is out of
   range and correct your program.

invalid arguments

   Facility: Shared by several facilities

   Explanation: This message is associated with a status code
   returned from the Run-Time Library. A calling program passed one
   or more invalid arguments to a library (LIB$) routine.

   User Action: Check the arguments for the call to the Run-Time
   Library and correct the program.





INVARGMAT

invalid argument to math library user PC location

   Facility: MTH, Mathematics Facility

   Explanation: One of the math procedures is called with an invalid
   argument.

   User Action: Locate the math procedure call that caused the error
   and correct the argument.

INVARGORD

invalid argument order

   Facility: LIB, Library Facility

   Explanation: The arguments were passed in an invalid order.

   User Action: Examine each argument. Correct the program to pass
   the arguments in a valid order.

INVARRDSC

invalid array descriptor

   Facility: DEBUG, VMS Debugger

   Explanation: An array descriptor in the image does not have
   the correct format. This can be caused by a reference to a VAX
   BASIC array when the first line of the program has not been
   executed. The array is not set up correctly until the BASIC
   program initialization is done. This message can also be caused by
   an applications program or a DEPOSIT command altering a compiler-
   generated array descriptor.

   User Action: If the reference is to a VAX BASIC array, enter a
   STEP or GO command to ensure that the BASIC program initialization
   is done and repeat the reference. Otherwise, if an array
   descriptor has not been altered, submit a Software Performance
   Report (SPR).

invalid array descriptor

   Facility: PATCH, Patch Utility

   Explanation: The expression contained an array descriptor that
   PATCH did not recognize.

   User Action: Correct the array descriptor and retry.


INVATTSIZ

invalid attribute record size in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the attribute size
   field of a save set record. Data in the save set is corrupted.

   User Action: None. Save set data has been lost.

INVATTSTR

invalid attribute record structure level in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the structure level
   field of a save set record. Data in the save set is corrupted.

   User Action: None. Save set data has been lost.

INVATTVAL

invalid attribute record value in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in a save set attribute
   record. Data in the save set is corrupted.

   User Action: None. Save set data has been lost.

INVBJLEOF

invalid end of file position in BACKUP journal

   Facility: BACKUP, Backup Utility

   Explanation: The end-of-file pointer recorded for the journal file
   specified by the /JOURNAL qualifier is invalid. The journal file
   is corrupted and cannot be used.

   User Action: Reconstruct the journal file from backup media.

INVBJLSIZ

invalid record size in BACKUP journal

   Facility: BACKUP, Backup Utility

   Explanation: An invalid record size occurred in the journal file
   specified by the /JOURNAL qualifier. The journal file is corrupted
   and cannot be used.

   User Action: Reconstruct the journal file from backup media.

INVBJLSTR

invalid structure level in BACKUP journal

   Facility: BACKUP, Backup Utility

   Explanation: The structure level recorded in the journal file
   specified by the /JOURNAL qualifier is invalid. The journal file
   is corrupted and cannot be used.

   User Action: Reconstruct the journal file from backup media.

INVBJLTYP

invalid record type in BACKUP journal

   Facility: BACKUP, Backup Utility

   Explanation: An invalid record type occurred in the journal file
   specified by the /JOURNAL qualifier. The journal file is corrupted
   and cannot be used.

   User Action: Reconstruct the journal file from backup media.

INVBKT

invalid bucket at VBN 'number'

   Facility: CONVERT, Convert Utility

   Explanation: The Convert/Reclaim Utility has detected a structure
   error in the bucket specified by 'number'.

   User Action: Use the ANALYZE/RMS_FILE command to determine the
   cause of the structure error.

INVBLK

invalid RMS control block at virtual address 'hex-offset'

   Facility: FDL, Create/FDL Utility

   Explanation: FDL$GENERATE or FDL$RELEASE is passed an address that
   is not a valid RMS control block.

   User Action: Correct the invalid address.

invalid RMS control block at virtual address 'XXXXXXXX'

   Facility: FDL, Edit/FDL Utility

   Explanation: The FDL parsing facility checks the validity of RMS
   blocks before deallocating them, and returns this error if a bad
   control block is found.

   User Action: Ascertain that the RMS control blocks passed to
   the FDL$RELEASE routine are in the same state as when they were
   created by the FDL$PARSE routine.


INVBLKHDR

invalid block header encountered in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the block header of a
   save set block. Data in the save set is corrupted.

   User Action: None. Save set data is lost.

INVBLKSIZE

invalid block size in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the block size field
   of a save set block. Data in the save set is corrupted.

   User Action: None. Save set data is lost.

INVBLKTYP

invalid block type in specified block

   Facility: SDA, System Dump Analyzer

   Explanation: SDA is unable to identify the block type of a
   particular block. The invalid block type message usually occurs
   when the SDA command FORMAT tries to identify a block type using a
   byte offset.

   User Action: None.

INVBLOCK

internal job controller error; invalid use of the block 'number'

   Facility: JBC, Job Controller

   Explanation: This message indicates a logic error in the job
   controller.

   User Action: None.

INVBTIMSP

invalid /BEGINNING time specification

   Facility: MONITOR, Monitor Utility

   Explanation: The value of the /BEGINNING qualifier is specified
   incorrectly. You must specify the time as an absolute time, plus
   or minus a delta time. You can omit either the absolute or the
   delta time; however, the delta time must always be preceded by
   the plus or minus sign. Whenever you use a plus sign, enclose
   the entire time specification in double quotes. See the VMS DCL
   Dictionary for more information on specifying time values.

   User Action: Reenter the MONITOR request with a correct value for
   the /BEGINNING qualifier.

INVBUFDELETE

cannot delete a permanent buffer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You attempted to delete a buffer that is set as a
   permanent buffer.

   User Action: None.

INVCALL

invalid CALL nesting structure or data inconsistency detected

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: There are three possible causes for these error
   messages:

   o  You mismatched or unpaired SUBROUTINE and ENDSUBROUTINE
      commands in a command procedure.

   o  You used the GOSUB command with a label defined with the
      SUBROUTINE command.

   o  You entered the command CALL, SUBROUTINE, or ENDROUTINE at an
      interactive (DCL) level.

   User Action: Correct the command procedure and reexecute the
   program.

INVCCFIL

invalid console carrier image file

   Facility: MOM, Maintenance Operation Module

   Explanation: The image that is being accessed to downline load the
   console carrier code is unsupported.

   User Action: Use a supported image type to downline load the
   console carrier code.

INVCHA

invalid character

   Facility: LIB, Library Facility

   Explanation: A character is unable to be translated when
   converting either from ASCII to EBCDIC or from EBCDIC to ASCII.

   User Action: Ensure that translatable characters are used.

INVCHAN

invalid ACP channel number

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INVCHANAM

invalid characteristic name

   Facility: JBC, Job Controller

   Explanation: The characteristic name specified is not
   syntactically valid. After logical name translation, the
   characteristic name must be a character string in the range
   of 1 to 31 characters. The character string must consist of
   alphanumeric characters, dollar signs, or underscore (_)
   characters.

   User Action: Correctly specify the characteristic name.

'name' is an invalid characteristic name

   Facility: QUEMAN, Queue Manager

   Explanation: The characteristic name specified is not
   syntactically valid. After logical name translation, the
   characteristic name must be a character string in the range
   of 1 to 31 characters. The character string must consist of
   alphanumeric characters, dollar signs, or underscore (_)
   characters.

   User Action: Correctly specify the characteristic name.


INVCHANUM

'number' is an invalid characteristic number

   Facility: QUEMAN, Queue Manager

   Explanation: The specified characteristic number is syntactically
   invalid.

   User Action: Correct the error and reenter the command.

INVCHAR

invalid character

   Facility: PATCH, Patch Utility,DEBUG, VMS Debuggerand REM, Set
   Host Facility

   Explanation: The command contained an invalid character.

   User Action: Correct the character and reenter the command.

invalid character encountered in position 'position'. It is ignored

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an invalid character while reading
   from a CLD file. The invalid character is ignored.

   User Action: Edit the CLD file such that there are no invalid
   characters.


INVCHDABS

invalid command in /ABSOLUTE context

   Facility: PATCH, Patch Utility

   Explanation: The command entered is invalid when patching a file
   in absolute context. Use of symbol names, patch area, or ECOs is
   invalid when invoking PATCH with the /ABSOLUTE qualifier.

   User Action: Enter a valid command. If you are patching an image,
   invoke the Patch Utility without the /ABSOLUTE qualifier.

INVCJFIOD

invalid IO database structure (journaling)

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INVCLADSC

invalid class in descriptor

   Facility: LIB, Library Facility

   Explanation: An unsupported class of descriptor is specified.

   User Action: Retry the operation specifying a supported class of
   descriptor.

INVCLADTY

invalid class data type combination in descriptor

   Facility: LIB, Library Facility

   Explanation: An unsupported class and data type combination is
   specified.

   User Action: Ensure that both the class and data type specified
   are supported.

INVCLIFLAG

invalid CLI flag 'flag-name' encountered

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an invalid CLI flag name while
   reading from a CLD file.

   User Action: Edit the CLD file so that all CLI flag names are
   valid.

INVCLSNM

class-name 'class-name' is invalid or not uniquely identified

   Facility: MONITOR, Monitor Utility

   Explanation: The specified class name is not a valid MONITOR
   class. This message can result from specifying a class name with
   too few characters to uniquely identify it.

   User Action: Check the list of valid MONITOR classes by entering
   the DCL command, HELP MONITOR parameters. Reenter the MONITOR
   command requesting only valid classes.

INVCMD

invalid command

   Facility: Shared by several facilities

   Explanation: Your command is invalid, either because the command
   parser cannot recognize the command, or because of incorrect
   syntax.

   User Action: If necessary, refer to the appropriate documentation,
   then reenter your command correctly.

unrecognized command

   Facility: NCP, Network Control Program

   Explanation: The specified verb is invalid.

   User Action: Check the input command for corrections and reenter
   the command.


INVCOL

invalid column

   Facility: SMG, Screen Management Facility

   Explanation: An invalid column number is specified. It is either
   less than 0 or larger than the number of columns in the virtual
   display.

   User
   Action: Specify a valid column. Columns are numbered beginning
   with 1.

INVCOLARG

unknown color specified

   Facility: SMG, Screen Management Facility

   Explanation: An attempt is made to change the characteristics of
   the terminal, changing its background color to a value that is not
   valid.

   User Action: Check the symbolic name for the background color
   desired. Specify it correctly.

INVCONT

invalid line continuation

   Facility: INPSMB, Input Symbiont

   Explanation: In a batch job entered from a card reader, a
   continued line is followed by a line beginning with a dollar sign.

   User Action: Correct the error and reenter the job.

INVCPUID

invalid CPU identification

   Facility: MONITOR, Monitor Utility

   Explanation: The CPU identification specified with the /CPU
   qualifier was invalid. Valid CPU identifications are integers
   0-31.

   User Action: Correct the CPU identification specification and
   reenter the MONITOR command.

INVCTX

invalid context block

   Facility: DCX, Data Compression/Expansion Utility

   Explanation: A DCX procedure is called with a context variable
   that is invalid or with an invalid or corrupted context area. This
   problem may be caused by failure to call the appropriate routine
   to initialize the context variable or by an application program
   error.

   User Action: Correct the application program.

INVCTXTYP

symbol specified is defined for a different context type

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You must use a symbol that has a type required by the
   lexical function you are using.

   User Action: Refer to the documentation of the lexical function
   for more information.

INVCVT

invalid conversion

   Facility: LIB, Library Facility

   Explanation: The source value is negative and the destination data
   type is unsigned.

   User Action: Ensure that the source value is positive and the
   destination data type is signed.

INVDATA

invalid data presented for expansion or bounded compression

   Facility: DCX, Data Compression/Expansion Utility

   Explanation: Two possible causes exist:

   o  DCX$COMPRESS_DATA is called to compress a data record that is
      not presented to DCX$ANALYZE_DATA when a bounded compression
      function had been requested.

   o  DCX$EXPAND_DATA is called to expand a compressed data record
      that is truncated or corrupted in some fashion.

   User Action: Correct the application program.

INVDATIM

invalid date/time in statement 'number'

   Facility: FDL, Create/FDL Utility

   Explanation: An invalid date or time is included in the specified
   statement.

   User Action: Correct the invalid date or time in the specified
   statement in the FDL file.

invalid date/time in statement 'xxx'

   Facility: FDL, Edit/FDL Utility

   Explanation: The date or time specified to the FDL parser is
   incorrectly formed.

   User Action: Verify that the syntax of the date and time is
   correct. The valid format is that of the SYS$BINTIM system
   service.


INVDEF

'directory spec' does not exist

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You set your default to a nonexistent directory using
   the SET DEFAULT command and then entered the SHOW DEFAULT command.

   User Action: Set default to a valid directory and reenter the SET
   DEFAULT command.

INVDEFATT

invalid key-definition attributes

   Facility: SMG, Screen Management Facility

   Explanation: When a key is defined, attributes such as NOECHO may
   be specified with the definition. An attempt is made to specify an
   unknown attribute.

   User Action: Check the list of valid attributes and correct your
   program.

INVDEFINE

invalid DEFINE statement

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an invalid DEFINE statement in a CLD
   file. Valid keywords for the DEFINE statement are: VERB, SYNTAX,
   and TYPE.

   User Action: Edit the CLD file so that the DEFINE commands contain
   proper syntax.

INVDELIM

invalid delimiter

   Facility: STR, String Manipulation Facility

   Explanation: The delimiter string passed to STR$ELEMENT is longer
   than a single character.

   User Action: Examine the delim_dec argument and make corrections.

INVDESC

invalid descriptor

   Facility: PPL, Parallel Processing Facility

   Explanation: The descriptor is invalid.

   User Action: Recode your program to correct the descriptor.

invalid string descriptor

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).


INVDEV

device is invalid for requested operation

   Facility: SET, SET Facility

   Explanation: The device type that is specified for the operation
   is not allowed in the particular operation. For example, the user
   enters the command SET DEVICE/SERVED CSA1 to serve the console
   floppy which is not allowed.

   User Action: Make sure that the device meets all of the
   requirements for the operation.

device name too long to add trailing ":"

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You specified a device name with more than 15
   characters.

   User Action: Limit the device name to 15 characters.


INVDEVICE

invalid device 'xxxxxx' specified

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The device indicated does not exist on the target
   system. If 'xxxxxx' is a logical name, then the translation of
   that logical name is not a valid device on the target system.

   User Action: Specify a valid device.

invalid device 'device-name'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: An invalid device is specified in the command.

   User Action: Reenter the command specifying a valid device. The
   specification must reference a disk device and must not contain
   any file specification components other than a device name.


INVDEVTYP

invalid backup device type 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The specified device must be a disk or tape device.

   User Action: Reenter the command.

INVDIR

invalid directive

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler accepts only a few FAO
   directives. It encountered one that it does not process.

   User Action: Check your terminal definition. Make sure that you
   use only valid FAO directives.

INVDIRNAM

invalid directory name: 'directory-name'

   Facility: DEBUG, VMS Debugger

   Explanation: The directory name 'directory-name' given in a
   SET SOURCE command is not valid. Either the directory syntax is
   incorrect or the directory does not exist.

   User Action: Ensure that the directory exists and that the syntax
   is correct.

INVDIS_ID

invalid display-id

   Facility: SMG, Screen Management Facility

   Explanation: An invalid display identifier is specified.

   User Action: Make sure you are passing the display identifier by
   reference, not by value. Ensure that the display id is previously
   set up by a call to SMG$CREATE_VIRTUAL_DISPLAY.

INVDPT

invalid driver image-DPT$_TYPE, VBN 2 .NEQ. DYN$C_DPT

   Facility: SYSGEN, System Generation Utility

   Explanation: The driver image file specified in a SYSGEN command
   LOAD, RELOAD, or CONNECT did not pass a basic validity check. This
   error can be caused by one of the following conditions:

   o  Not having the driver prologue table (DPT) as the first code-
      generating component of the driver

   o  Not linking the driver as an executable image based at zero

   o  Having PSECT statements in the driver program

   o  Any other problem that causes the driver prologue table not to
      be in the second block (VBN 2) of the image file

   User Action: Correct the driver code and reenter the command.

INVDPTINI

invalid driver prologue init table value

   Facility: SYSGEN, System Generation Utility

   Explanation: One of the following conditions exists:

   o  The initialization or reinitialization entry in the driver
      prologue table has an invalid control block type code, that is,
      one other than DDB, UCD, CRB, or IDB.

   o  The initialization or reinitialization entry in the driver
      prologue table has an invalid store function, that is, one
      other than B, W, L, R, V, @B, @W, @L, @R, or @V.

   User Action: Correct the DPT_STORE macro in the driver prologue
   table.

INVDSTQUE

invalid destination queue

   Facility: JBC, Job Controller

   Explanation: The destination queue name specified is not
   syntactically valid. After logical name translation, the
   destination queue name must be a character string in the range
   of 1 to 31 characters. The character string must consist of
   alphanumeric characters, dollar signs, and underscore (_)
   characters.

   User Action: Correctly specify the destination queue.

INVDSTREC

invalid DST record

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: An invalid Debug Symbol Table record is encountered.
   This can be caused by a DEPOSIT to a random location or it may be
   a compiler error.

   User Action: Submit a Software Performance Report unless the
   applications program or a DEPOSIT command has altered a Debug
   Symbol Table record.

unimplemented delta-PC command in symbol table

   Facility: TRACE, Traceback Facility

   Explanation: A language processor has created a PC-to-line-number
   record that the traceback facility has not implemented. The symbol
   table information is either incorrect or is not known to the
   traceback facility.

   User Action: Submit a Software Performance Report (SPR).


INVDTYDSC

invalid data type in descriptor

   Facility: LIB, Library Facility

   Explanation: An unsupported data type is specified.

   User Action: Retry the operation specifying a supported data type.

INVELEID

invalid element ID

   Facility: PPL, Parallel Processing Facility

   Explanation: The specified element ID is not valid.

   User Action: Examine the program code. Some modification of the
   element ID occurred.

INVELENAM

invalid element name

   Facility: PPL, Parallel Processing Facility

   Explanation: An invalid character string is detected.

   User Action: Specify a valid character string.

INVELETYP

invalid element type for requested operation

   Facility: PPL, Parallel Processing Facility

   Explanation: You specified an element type that cannot be used by
   the called routine.

   User Action: Recode the program to pass a valid element type.

INVETIMSP

invalid /ENDING time specification

   Facility: MONITOR, Monitor Utility

   Explanation: The value of the /ENDING qualifier is specified
   incorrectly. You must specify the time as an absolute time plus or
   minus a delta time. You can omit either the absolute or the delta
   time; however, the delta time must always be preceded by the plus
   or minus sign. Whenever you use a plus sign, enclose the entire
   time specification in double quotes. See the VMS DCL Dictionary
   for more information on specifying time values.

   User Action: Reenter the MONITOR request with a correct value for
   the /ENDING qualifier.

INVEVE

invalid event range

   Facility: NCP, Network Control Program

   Explanation: The range of event types is invalid.

   User Action: Reenter a valid event list.

INVEXCEPTN

exception while above ASTDEL or on interrupt stack

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INVEXHLIST

termination handler control block list is corrupted

   Facility: SYSTEM, VMS System Services

   Explanation: The list of exit handler control blocks is in an
   inconsistent state, either because the same exit handler is
   declared more than once or because user code has minpulated one of
   the list pointers.

   User Action: The program is in error. Change the source code that
   is incorrectly manipulating the termination handler control block
   list.

INVEXP

invalid expression

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler encountered an invalid
   arithmetic expression.

   User Action: Check your definition. Make sure that you have used
   only valid operators and operands in your expressions.

INVEXTBACK

file ('file-id') 'filename' invalid extension file header back link

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility has found that the back link in an
   extension file header for the specified file does not point to the
   primary file header.

   User Action: None. The back link is changed to point to the
   primary file header.

INVEXTFID

file ('file-id') 'filename' invalid extension file header forward
link

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility has found that the forward link in
   a file header to the next extension file header does not point to
   a valid file header.

   User Action: Examine and delete the file. If possible, reconstruct
   the file from backup media.

INVEXTHDR

file ('file-id') 'filename' invalid extension file header sequence

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility has found that the sequence
   numbers in the extension file headers for the specified file are
   not correct. The sequence number should increase by one in each
   extension file header.

   User Action: The link that points to the erroneous extension file
   header is cleared. Part of the file cannot be accessed by the
   operating system. You should delete the file and, if possible,
   reconstruct it from backup media.

INVFAOPARAM

FAO parameter 'integer' must be string or integer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The FAO built-in procedure allows only string and
   integer arguments.

   User Action: Specify string and integer arguments only to the FAO
   built-in procedure.

INVFCBDESC

descriptor in $FCB for 'address' improperly initialized

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU error occurred.

   User Action: Submit a Software Performance Report (SPR).

INVFCO

invalid file contents, 'filename'

   Facility: NCP, Network Control Program

   Explanation: Your command could not access the file, because
   the file's contents are invalid. An accompanying VMS RMS message
   should identify the reason why the file contents are invalid.

   User Action: Take corrective action based on the accompanying VMS
   RMS message.

INVFID

invalid file id in save set-cannot restore /IMAGE

   Facility: BACKUP, Backup Utility

   Explanation: An attempt is made to restore a file with a zero file
   identification in /IMAGE mode. This may occur if the save set is
   written by a non-VMS system.

   User Action: Use a non-/IMAGE mode to restore the file.

INVFILEXT

invalid file extension linkage in 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The specified save set file has an invalid pointer to
   a following segment of the file. The remainder of the file is not
   accessible.

   User Action: Attempt to recover data by beginning a restore
   operation with the first unprocessed file segment.

INVFILSPE

boot file specification too long

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: You specified an invalid load assist parameter with
   the system root specification.

   User Action: Shorten the file specification for the system root.

input or output file specification too long-shorten

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A file specification is invalid.

   User Action: Reenter the command, specifying a valid file
   specification.

invalid file specification

   Facility: LIB, Library Facility

   Explanation: An invalid file specification is specified in a
   CREATE/DIRECTORY, SET PROTECTION, RENAME, or UNLOCK command.

   User Action: Refer to the VMS DCL Dictionary and reenter the
   command.

invalid file specification 'filespec'

   Facility: PRINT, PRINT Command and SUBMIT, SUBMIT Command

   Explanation: The specified file specification is invalid. Files
   submitted to a batch or print job must be disk files.

   User Action: Correct the error and reenter the command.




INVFIXDST

invalid DST fixup records in image 'image-name', symbol references
to shareable images may be erroneous

   Facility: DEBUG, VMS Debugger

   Explanation: While attempting to read the Debug Symbol Table
   (DST) in the specified image, the debugger found errors in the DST
   address fixup records. These records are used to adjust for the
   base addresses of shareable images. This means that any symbols
   in this image that point to addresses in other (shareable) images
   are most likely incorrect. Symbols that refer to addresses in this
   image are correct unless this is also a shareable image.

   User Action: Relink the image and, if the error is reproducible,
   submit a Software Performance Report explaining how the image file
   is created.

INVFLUSHSP

invalid /FLUSH_INTERVAL specification

   Facility: MONITOR, Monitor Utility

   Explanation: The value of /FLUSH_INTERVAL must be an unsigned
   contiguous string of decimal digits forming a value in the range
   of 1 to 9,999,999, inclusive.

   User Action: Reenter the MONITOR request and specify a valid value
   for /FLUSH_INTERVAL.

INVFORNAM

invalid form name

   Facility: JBC, Job Controller

   Explanation: The form name specified is not syntactically valid.
   After logical name translation, the form name must be a character
   string whose length is in the range of 1 to 31 characters. The
   character string must consist of alphanumeric characters, dollar
   signs, and underscore (_)  characters.

   User Action: Correctly specify the form name.

'name' is an invalid form name

   Facility: QUEMAN, Queue Manager

   Explanation: The form name specified is not syntactically valid.
   After logical name translation, the form name must be a character
   string whose length is in the range of 1 to 31 characters. The
   character string must consist of alphanumeric characters, dollar
   signs, and underscore (_)  characters.

   User Action: Correctly specify the form name.


INVFORNUM

'number' is an invalid form number

   Facility: QUEMAN, Queue Manager

   Explanation: The specified form number is syntactically invalid.

   User Action: Correct the error and reenter the command.

INVFUNC

invalid function (valid choices are: SAVE, RESTORE, TEST, COMPARE)

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An invalid function was requested for the queue
   upgrade utility.

   User Action: Enter one of the valid function choices.

INVFUNCOD

invalid function code

   Facility: JBC, Job Controller

   Explanation: The $GETQUI, $SNDACC, $SNDJBC, or $SNDSMB function
   code is invalid.

   User Action: Identify and correct the incorrect function code.

INVGBLSELDATA

the selected data cannot be processed

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU cannot process the data of the selected
   region.

   User Action: Select 8-bit uniform font text when pasting the
   global selection into VAXTPU.

INVGOSUB

invalid use of the GOSUB command

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You entered the GOSUB command in an environment other
   than a command procedure. This command is invalid in interactive
   mode.

   User Action: Use the GOSUB command only in command procedures.

INVHEADER_BUSY

invalid file header marked "busy" in index file bitmap

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: This message is issued along with the BADHEADER
   message and gives a more detailed reason why the specified file
   header is corrupt. In this case, the file header is corrupt
   (for reasons given in other messages) but the index file bitmap
   indicates that the file header is busy.

   User Action: None. See the BADHEADER message.

INVHOMBLK

'device-name' has invalid home block

   Facility: BACKUP, Backup Utility

   Explanation: The specified volume has an invalid Files-11 home
   block.

   User Action: Repair the volume with the Verify Utility.

INVIDE

invalid identification, 'component-id'

   Facility: NCP, Network Control Program

   Explanation: The format of a component identifier is incorrect,
   or the KNOWN component keyword is used where it is not valid. The
   'component-id' will identify the invalid identification.

   User Action: Check the syntax rules for component identifiers and
   reenter your command with the correct syntax.

INVIFNEST

invalid IF-THEN-ELSE nesting structure or data inconsistency

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An IF-THEN-ELSE statement is incorrectly structured.

   User Action: Modify your command procedure using the correct IF-
   THEN-ELSE structure. Check for inconsistent data types.

INVIMGHDR

inconsistent debug and symbol data in image header

   Facility: PATCH, Patch Utility

   Explanation: The image header inconsistently describes the symbol
   information causing the absence of symbol information at PATCH
   time.

   User Action: Relink the image. If the problem persists, submit a
   Software Performance Report (SPR).

INVINPDMN

invalid input domain

   Facility: CDA

   Explanation: An invalid input domain was specified for the front
   end. Only DDIF and DTIF are supported as domains.

   User Action: Currently, DDIF and DTIF are the only input domains
   supported.

INVINPFIL

the /INPUT qualifier file is not a valid MONITOR recording file

   Facility: MONITOR, Monitor Utility

   Explanation: The file specified with the /INPUT qualifier is not
   a MONITOR recording file. When MONITOR creates a recording file,
   identification information is stored in the header record; this
   information is then verified when the file is used for input. The
   file specified on this MONITOR request failed the verification.

   User Action: Reenter the MONITOR request, specifying a valid
   MONITOR recording file with the /INPUT qualifier.

INVINPUT

invalid input format in file 'filename'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: The format of the input file is incorrect.

   User Action: Correct the format of the input file.

INVINTSP

invalid /INTERVAL specification

   Facility: MONITOR, Monitor Utility

   Explanation: The /INTERVAL qualifier value must be an unsigned
   contiguous string of decimal digits forming a value in the range
   of 1 to 9,999,999 inclusive.

   User Action: Reenter the MONITOR request, specifying a valid
   /INTERVAL qualifier value.

INVIOCODE

invalid operation code passed to an I/O operation

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An invalid request is passed to enter the file
   operation routine or the terminal input routine provided by
   VAXTPU.

   User Action: If you are using the callable interface, correct your
   program. If you are not using the callable interface, a software
   error has occurred. In such a case, please submit a Software
   Performance Report describing the conditions that lead to the
   error.

INVITEM

invalid item code or list

   Facility: DCX, Data Compression/Expansion Utility

   Explanation: DCX$ANALYZE_INIT is called with either an incorrect
   number of arguments (the number must be odd) or an unknown item
   code argument.

   User Action: Correct the application program.

invalid item 'item-name' encountered. Some text will be skipped

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an unexpected item while reading from
   a CLD file. The unexpected item is ignored.

   User Action: Make sure that all commands in the CLD file contain
   correct syntax.


INVITEMCODE

invalid item code specified in list

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU error occurred.

   User Action: Submit a Software Performance Report (SPR).

INVITEMNM

the /ITEM qualifier name 'item-name' is invalid or not uniquely identified

   Facility: MONITOR, Monitor Utility

   Explanation: The specified item name is not defined for the
   class with which it is specified. This message can result from
   specifying an item name with too few characters to uniquely
   identify it.

   User Action: Check the list of items defined for the requested
   class by entering: HELP MONITOR /ITEM. Reenter the MONITOR command
   requesting only valid items.

INVITMCOD

invalid item code, item code = 'item code (hex)'

   Facility: PSM, Print Symbiont

   Explanation: An invalid item code is detected.

   User Action: Specify a valid item code.

invalid item code or option code

   Facility: JBC, Job Controller

   Explanation: The $GETQUI or $SNDJBC item list contains an invalid
   item code, or the $SNDSMB or $SNDACC option list contains an
   invalid option code.

   User Action: Correct the invalid item code or option code.


INVKBD_ID

invalid keyboard-id

   Facility: SMG, Screen Management Facility

   Explanation: An invalid keyboard id is passed.

   User Action: Make sure you are passing the keyboard id by
   reference, not by value. Ensure that the keyboard id is previously
   set up by a call to SMG$CREATE_VIRTUAL_KEYBOARD.

INVKEY

invalid key

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. The specified key is either of zero length or it is
   greater than the maximum allowable length.

   User Action: Either change the module name or change the name
   length limit of the library.

unrecognized keyword

   Facility: NCP, Network Control Program

   Explanation: NCP could not recognize a keyword in the command
   string. This error is returned when the keyword is entered in
   response to a prompt.

   User Action: Reenter the requested information.


INVKEYCHAR

key not inserted; 'ASCII-character' (%X'hexadecimal-byte') is not a
valid key character

   Facility: LIBRAR, LIBRARY Command

   Explanation: The flagged character is not permitted in a HELP key.
   If the HELP key is a level one key (topic), the module will not be
   inserted into the HELP library.

   User Action: Edit the module in the HELP file to remove the
   invalid character from the key.

INVKEYNAM

invalid key name

   Facility: SMG, Screen Management Facility

   Explanation: The specified key name is less than 1 character or
   more than 31 characters.

   User Action: Choose a key name with 1 to 31 characters.

INVKTB_ID

invalid key-table-id

   Facility: SMG, Screen Management Facility

   Explanation: An invalid key table id is passed.

   User Action: Make sure you are passing the key table id by
   reference, not by value. Ensure that the key table id is
   previously set up by a call to SMG$CREATE_KEY_TABLE.

INVLDADR

invalid virtual address

   Facility: SDA, System Dump Analyzer

   Explanation: The virtual address lies outside the boundries of the
   virtual addresses mapped by the system page table (SPT).

   User Action: Reenter the command, specifying a valid virtual
   address.

INVLDRESP

invalid operator response

   Facility: MOUNT, Mount Utility

   Explanation: The operator responded to a request with an invalid
   reply.

   User Action: None. The request is automatically reentered.

INVLOCKID

invalid lock id

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INVLOG

transaction log file format is invalid

   Facility: SYSTEM, VMS System Services

   Explanation: The format of the transaction log file is invalid.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and include a BACKUP
   save set containing the output of the LMCP DUMP and the DCL DUMP
   commands for the given log file.

INVLOGFIL

invalid log file specification

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: In a SUBMIT command, the log file specification
   is invalid. This message is issued with an accompanying message
   providing more information.

   User Action: Refer to the VMS DCL Dictionary and reenter the
   command specifying a valid file specification.

invalid log file specification

   Facility: INPSMB, Input Symbiont, QUEMAN, Queue Manager, and
   SUBMIT, SUBMIT Command

   Explanation: The specified log file specification is syntactically
   invalid. The accompanying message provides additional information.

   User Action: Take corrective action based on the accompanying
   message.

invalid log file specification

   Facility: Shared by several facilities

   Explanation: The batch log file specification supplied with
   the /LOG_FILE qualifier is invalid. The file specification
   must reference a disk file and must not contain a node name or
   wildcards.

   User Action: Respecify the batch log file specification using the
   correct syntax.



INVLOGIN

login information invalid at remote node

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt is made to initiate a DECnet logical link
   connection.

   User Action: The access control string specified is incorrect. If
   default access control is used, notify the system manager that the
   DECnet configuration database needs to be updated.

   This error can be returned if the specified access control string
   is not recognized (for example, no record in the UAF), or is too
   long, or contained invalid characters.

INVMAP

invalid map

   Facility: DCX, Data Compression/Expansion Utility

   Explanation: A DCX procedure is called with an incorrectly formed
   map argument or with an invalid context area.

   User Action: Correct the application program.

INVMAR

right margin must be greater than left

   Facility: DEBUG, VMS Debugger

   Explanation: You specified a right margin that is less than the
   left margin in a SET MARGIN command. The right margin must be
   greater than the left margin.

   User Action: Specify a valid margin range and reenter the command.

INVMAXLEN

invalid maximum length (greater than 512)

   Facility: SMG, Screen Management Facility

   Explanation: The maximum length specified for an input string is
   too long.

   User Action: Correct your program so that it requests an input
   string of 512 characters or less.

INVMODE

invalid mode parameter

   Facility: DTK, DECtalk Facility

   Explanation: The value of the mode argument is not in the correct
   range.

   User Action: Examine the argument. Determine which value is out of
   range and correct your program.

INVMSG

invalid mailbox message received

   Facility: JBC, Job Controller

   Explanation: The job controller received an invalid mailbox
   message. This message indicates a logic error in the system or
   in the job controller interface of a user-written symbiont.

   User Action: Identify the cause of the problem.

INVMSGBUF

invalid message buffer

   Facility: JBC, Job Controller

   Explanation: The $SNDSMB or $SNDACC message buffer is invalid
   because it is not long enough to contain all required fields or an
   option extends beyond the end of the message buffer.

   User Action: Correct the message buffer format and retry the
   system service call.

INVNAM

invalid NAM block

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. The NAM block passed to LBR$INI_CONTROL is invalid.

   User Action: Correct the NAM block before calling the routine.

INVNBDS

invalid Numeric Byte Data String

   Facility: LIB, Library Facility

   Explanation: The string of bytes specified as a NBDS is not a
   NBDS. Numeric Byte Data Strings are explained in the LIB$CVT_DX_DX
   routine documentation in the VMS RTL Library (LIB$) Manual.

   User Action: Check the NBDS descriptor against LIB$CVT_DX_DX
   documentation.

INVNUMBER

invalid numeric string

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: You specified a numeric data string that is invalid
   in the current context.

   User Action: Specify the value in another numeric format or set
   the language to one that accepts this type of numeric string.

INVNUMCHI

invalid number of children, must be positive

   Facility: PPL, Parallel Processing Facility

   Explanation: You tried to create a number less than 1.

   User Action: Recode the program to request a value greater than or
   equal
   to 1.

INVNUMSRC

invalid number of source files

   Facility: DEBUG, VMS Debugger

   Explanation: An invalid number of source files is specified with
   the SET MAX_SOURCE_FILES command. The number of source files that
   the debugger keeps open simultaneously must be in the range of 1
   through 20.

   User Action: Reenter the command specifying a valid number within
   the range of 1 through 20.

INVNUMSTR

invalid numeric string

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The specified string can not be converted to a
   number.

   User Action: Use a string that correctly represents a number.

INVOOB

invalid out of band character

   Facility: REM, Set Host Facility

   Explanation: An attempt was made to define an illegal out-of-band
   character.

   User Action: Redefine the out-of-band character. Under VMS,
   characters 0-31 are legal out-of-band characters.

INVOPCODE

opcode in delayed work queue is invalid

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

INVOPER

invalid operation specified

   Facility: LIB, Library Facility

   Explanation: The operation code is out of range or invalid

   User Action: Examine the operation code. Replace it with a valid
   operation code.

INVOPEZON

invalid operation for zone

   Facility: LIB, Library Facility

   Explanation: The item code is invalid for the specified zone. This
   message is also returned for an invalid use of an unspecified user
   zone action routine.

   User Action: Specify a valid item code.

INVOPR

unrecognized operator in expression

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: The expression contained a character in place of a
   valid operator that PATCH or DEBUG does not recognize.

   User Action: Reenter the command with a valid expression.

INVOPRND

unable to resolve operand 'xx'

   Facility: PATCH, Patch Utility

   Explanation: You specified an operand that PATCH does not
   recognize. Operands such as 4(R0) must be preceded by B^, for
   example, B^4(R0).

   User Action: Retry the operation specifying a valid operand.

INVOPTION

non-supported flow control parameter received

   Facility: DTR, DECnet Test Program Protocol

   Explanation: This message indicates a DECnet test program protocol
   incompatibility.

   User Action: Run with a compatible version of DTRECV or
   equivalent.

INVOPTIONS

to specify options, parameter 3 must be the word OPTIONS.

   Facility: VMSINSTAL, Install Procedures

   Explanation: If you are specifying VMSINSTAL options, the third
   parameter to VMSINSTAL must be the word OPTIONS.

   User Action: Restart VMSINSTAL, and specify the options in the
   correct format.

INVOUTDMN

invalid output domain

   Facility: CDA

   Explanation: An invalid output domain was specified for the back
   end. Only DDIF and DTIF are supported as domains.

   User Action: Currently, DDIF and DTIF are the only output domains
   supported.

INVOUTSPE

invalid output file assignment

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You specified an invalid or null file specification
   in defining SYS$OUTPUT.

   User Action: Reenter the command with a correct file
   specification.

INVOVERQUOTA

invalid overdraft quota specified

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A DISKQUOTA ADD or MODIFY function specified an
   invalid overdraft quota (nonnumeric, negative, or larger than
   32 bits).

   User Action: Respecify the command with a valid quota.

INVPAGARG

height of 0 is not permitted

   Facility: SMG, Screen Management Facility

   Explanation: An attempt is made to change the characteristics of
   the terminal, setting the height (page size) to 0.

   User Action: Correct the code. A height of 0 is invalid.

INVPARAM

parameter 'numbers', datatype 'type' illegal, expected 'type'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A built-in procedure is invoked with an invalid data
   type as one of its parameters.

   User Action: Specify a valid data type.

parameter value illegal (nonnumeric or too large)

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A PARAMETERS SET command specified an invalid
   value for a parameter. The parameter is too large (for a numeric
   parameter) or contains invalid numeric digits.

   User Action: Supply a valid parameter value.


INVPARFIL

invalid parameter file

   Facility: SYSGEN, System Generation Utility

   Explanation: An error occurred accessing the file specified in a
   USE or WRITE operation.

   User Action: Check that the file is not protected against read or
   write access and then reenter your command. If the error reoccurs,
   but the file can be read or written by other utilities, submit a
   Software Performance Report (SPR). Include a copy of the invalid
   parameter file with the SPR.

INVPARLEN

invalid parameter length

   Facility: JBC, Job Controller

   Explanation: The buffer length specified for a $GETQUI or $SNDJBC
   item, or the length of a string specified with a $SNDSMB option,
   is outside the valid range for that item.

   User Action: Specify a valid buffer length and retry the system
   service call.

INVPARM

parameter identifiers must be in the form Pn

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a parameter definiton in which the
   parameter being defined is not in the form Pn. All parameters must
   be in the form Pn.

   User Action: Edit the CLD file so that all defined parameters are
   in the form Pn.

INVPARVAL

invalid parameter value

   Facility: JBC, Job Controller

   Explanation: The parameter value specified for a $GETQUI or
   $SNDJBC item, or a $SNDACC or $SNDSMB option, is outside the valid
   range for that item.

   User Action: Specify a valid value for the specified item and
   retry the system service call.

INVPAS_ID

invalid pasteboard-id

   Facility: SMG, Screen Management Facility

   Explanation: An invalid pasteboard identifier is specified.

   User Action: Make sure that you are passing the pasteboard
   identifier by reference, not by value. A reference to a 0 is
   valid, since 0 is a valid pasteboard identifier. Make sure the
   pasteboard is previously set up by a call to SMG$CREATE_PASTEBOARD
   and that the pasteboard has not been deleted.

INVPASS

invalid password 'password'

   Facility: INPSMB, Input Symbiont

   Explanation: The specified password is syntactically invalid.

   User Action: Correct the error and reenter the job.

INVPATH

invalid path name started by 'string'

   Facility: PATCH, Patch Utility

   Explanation: This message indicates an incorrect use of path name
   rules.

   User Action: Correct the path name according to path name rules
   and retry.

INVPERMQUOTA

invalid permanent quota specified

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A DISKQUOTA ADD or MODIFY function specified an
   invalid permanent quota (nonnumeric, negative, or larger than
   32 bits).

   User Action: Respecify the command with a valid quota.

INVPGP

invalid parameter grouping

   Facility: NCP, Network Control Program

   Explanation: The request contained multiple parameters that are in
   incompatible groups. For example, the executor name and address
   cannot be set together.

   User Action: Divide the command into multiple commands, one
   command for each parameter group.

INVPLACE

placement must be GLOBAL, LOCAL, or POSITIONAL

   Facility: CDU, Command Definition Utility

   Explanation: An invalid keyword value is specified for the
   PLACEMENT qualifier. Valid keyword values for the PLACEMENT
   qualifier are GLOBAL, LOCAL, and POSITIONAL.

   User Action: Edit the CLD file so that each PLACEMENT keyword
   value is one of the following: GLOBAL, LOCAL, or POSITIONAL.

INVPRVNAM

'privilege' is not a valid privilege

   Facility: INSTALL, Install Utility

   Explanation: An invalid privilege name is specified.

   User Action: Correct the privilege name and reenter the command.

INVPTEFMT

invalid page table entry format

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INVPVA

invalid parameter value

   Facility: NCP, Network Control Program

   Explanation: The specified value for a parameter is invalid; for
   example, a line identifier or a load address is incorrect.

   User Action: Check the rules for specifying the parameter value
   and reenter the command.

INVPWD

invalid password

   Facility: CAF, Cluster Authorization File Service

   Explanation: A cluster password contains characters other than
   A-Z, 0-9, $, hyphen, and underscore.

   User Action: Reenter the command with a valid password.

INVPWDLEN

invalid password length-password not changed

   Facility: CAF, Cluster Authorization File Service

   Explanation: A cluster password is null or has more than 31
   characters.

   User Action: Reenter the command with a valid password.

invalid password length-password not changed

   Facility: SET, SET Facility

   Explanation: A password is specified whose length is outside the
   range established for valid passwords.

   User Action: Make sure the password is the correct length and, if
   necessary, change the password and reenter the command.


INVQUAL

invalid qualifier

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You entered an invalid qualifier for a DCL command.

   User Action: Check your documentation for the command and reenter
   it using the correct qualifier name.

INVQUAVAL

value 'nn' invalid for /'qualifier' qualifier

   Facility: BACKUP, Backup Utility

   Explanation: The specified value is not valid for the specified
   qualifier.

   User Action: Check the range of valid values for the qualifier and
   reenter the command.

value 'value' invalid for qualifier 'qualifier'

   Facility: ERF, Error Log Utility

   Explanation: An invalid qualifier was specified.

   User Action: Use the DCL HELP command or refer to the VMS DCL
   Dictionary for the valid qualifier values. Then reenter your
   command.


INVQUENAM

invalid queue name

   Facility: JBC, Job Controller

   Explanation: The queue name specified is not syntactically valid.
   After logical name translation, the queue name must be a character
   string whose length must be in the range of 1 to 31 characters.
   The character string must consist of alphanumeric characters,
   dollar signs, and underscore (_)  characters.

   User Action: Specify a syntactically valid queue name.

INVQUO

quoted argument not allowed in current mode

   Facility: PATCH, Patch Utility

   Explanation: You attempted to enter an argument enclosed in
   quotation marks or apostrophes when you were not in INSTRUCTION or
   ASCII mode.

   User Action: Remove the quotation marks or apostrophes and retry
   the operation. Or if you are entering instructions or ASCII data,
   indicate this in the command.

INVRANGE

field specification is out of bounds-check sign and size

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The offset and/or length arguments specify a location
   that is out of the valid range of this operation.

   User Action: Check the offset and length; also check the size of
   the item on which you are operating.

invalid range enclosure specified

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The specified range encloses text in an invalid way.

   User Action: Specify a range of text that consists of either
   complete lines or a fragment of a single line.


INVRECFMT

record format specified inconsistent with volume format

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility found that the format option on
   the /RECORD_FORMAT qualifier is not valid for the volume against
   which it is applied.

   User Action: It is very seldom necessary to use a /RECORD_FORMAT
   qualifier, since the defaults taken by EXCHANGE are usually
   correct. If it is necessary to use a /RECORD_FORMAT qualifier,
   make sure it is on the correct file specification. It is possible
   to put /RECORD_FORMAT on either input or output specifications (or
   even on both), depending on the command.

INVRECORD

invalid record type in file 'filename'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: An invalid record type is encountered in the file.

   User Action: Make sure that the file contains the correct record
   type.

INVRECSIZ

invalid record size in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the record size field
   (BRH$W_RSIZE) of a save set record. Data in the save set is
   corrupted.

   User Action: None. Save set data is lost.

INVRECTYP

invalid record type in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the record type field
   of a save set record. Data in the save set is corrupted.

   User Action: None. Save set data is lost.

INVREPTYP

invalid report type

   Facility: ERF, Error Log Utility

   Explanation: An internal consistency error was encountered.

   User Action: Submit a Software Performance Report (SPR).

INVREQ

invalid startup parameter

   Facility: START, System Startup Driver

   Explanation: The startup driver is executed with an invalid first
   parameter.

   User Action: If the error occurs during a system boot, check the
   value of the SYSGEN parameter STARTUP_P1. If errors occur after
   a @STARTUP command procedure, verify that the first parameter is
   FULL, MINIMUM, UPGRADE, or the name of the system component to
   restart.

INVREQCOD

not a valid request code

   Facility: SMG, Screen Management Facility

   Explanation: Data is requested from Termtable through request
   codes that are available as symbolic names. The code you have
   specified is invalid.

   User Action: Check the spelling of the symbolic name you are
   using.

INVREQPARM

line 'line-number': All required parameters must precede optional
ones

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a REQUIRED parameter specification
   after an OPTIONAL parameter is specified. All REQUIRED parameter
   specifications must precede OPTIONAL parameter specifications.

INVREQTYP

invalid request type

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This message is associated with an internal status
   code returned from the command interpreter result parse routine;
   it indicates a request to perform an unimplemented function.

   User Action: Submit a Software Performance Report (SPR).

INVRFA

invalid RFA

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. The specified RFA is invalid.

   User Action: Correct the RFA before calling the routine.

INVRFM

invalid record format-file must be FIXED length

   Facility: CAF, Cluster Authorization File Service

   Explanation: The file SYS$SYSTEM:CLUSTER_AUTHORIZE.DAT has an
   invalid format.

   User Action: Delete and re-create the file on all cluster members
   with a CONFIGURATION SET CLUSTER_AUTHORIZATION command at the
   SYSMAN> prompt.

invalid record format for record I/O-file not opened

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This message is returned by the DCL command OPEN
   if the file you are trying to open has a record format that is
   incompatible with record I/O.

   User Action: You cannot use DCL to read or write to this file.


INVROUT

invalid routine specified in command tables-check .CLD file

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A user-defined command attempted to invoke a routine
   that DCL could not find.

   User Action: Correct the command definition file.

line 'line-number': A ROUTINE clause is only valid when generating
an object file

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a ROUTINE clause while not generating
   an object file. The ROUTINE clause is only valid when object file
   generation is requested.

   User Action: Edit the CLD file to remove the ROUTINE clause or
   specify the /OBJECT qualifier in the SET COMMAND.


INVROW

invalid row

   Facility: SMG, Screen Management Facility

   Explanation: An invalid row number is specified. It is either less
   than 0 or larger than the number of rows in the virtual display.

   User Action: Specify a valid row number. Rows are numbered
   beginning with 1.

INVRSP

invalid management response

   Facility: NCP, Network Control Program

   Explanation: Either NCP could not recognize the form of the
   response from the network management listener (NML) or the
   response is inappropriate.

   User Action: Submit a Software Performance Report (SPR).

invalid response

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Your response is invalid.

   User Action: Respond to the "Do you . . . " message that follows
   this message.


INVRSPID

RSPID not valid

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INVSCRPOS

invalid screen position

   Facility: LIB, Library Facility

   Explanation: Zero is specified for either the line number or the
   column number.

   User Action: Do not specify zero for either the line number or the
   column number.

INVSEMINI

invalid semaphore initial value, cannot exceed its maximum value

   Facility: PPL, Parallel Processing Facility

   Explanation: A semaphore initial value must be less than or equal
   to its maximum value.

   User Action: Lower the specified initial value. Check the values
   of the parameters semaphore_maximum and semaphore_initial, and
   adjust the incorrect value accordingly.

INVSEMMAX

invalid semaphore maximum value, must be positive

   Facility: PPL, Parallel Processing Facility

   Explanation: A semaphore's maximum value must be positive.

   User Action: Change the specified maximum value to a positive
   value.

INVSHDWMEM

shadow set member ddcu: is 'newer' than the shadow set

   Facility: MOUNT, Mount Utility

   Explanation: Volumes being added to an existing shadow set cannot
   have a higher generation number than the shadow set.

   User Action: Determine which volume should be the target of the
   shadow copy operation. Recreate the shadow set, and add the target
   of the copy operations to it.

INVSMG

invalid message format

   Facility: NCP, Network Control Program

   Explanation: The network management message is too long or
   too short (for example, it may contain too much data or not
   enough data), or a field is not correctly formatted for the data
   expected.

   User Action: Submit a Software Performance Report; include the
   command that caused this error.

INVSPEED

invalid speed

   Facility: REM, Set Host Facility

   Explanation: The selected speed is invalid.

   User Action: Correct the speed and reenter the command.

INVSRCLIN

invalid source line range

   Facility: DEBUG, VMS Debugger

   Explanation: An invalid source line range is entered with the TYPE
   command. The first line number of the range must be nonnegative
   and less than or equal to the second number in the range.

   User Action: Reenter the command specifying a valid line number
   range.

INVSTANAM

invalid state name

   Facility: SMG, Screen Management Facility

   Explanation: The specified state name is less than 1 character or
   more than 31 characters.

   User Action: Choose a state name with 1 to 31 characters.

INVSTLEVEL

structure level is invalid or already up to current structure level

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred while executing a MONITOR CONVERT
   command. The structure level of the input file is either unknown
   or already up to the current MONITOR structure level.

   User Action: Try to play back the MONITOR recording file. If it
   plays back properly, it is already up to the current structure
   level. If it still does not play back, the structure level is
   unknown to this version of MONITOR.

INVSTMNBR

invalid stream number

   Facility: SMB, Symbiont Services

   Explanation: An invalid stream number is detected. This is a fatal
   return status.

   User Action: Please submit a Software Performance Report (SPR).

INVSTR

string too long for field

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The character string you specified is too long.

   User Action: See the VMS Authorize Utility Manual for information
   on character string length restrictions.

INVSTRDES

invalid string descriptor

   Facility: LIB, Library Facility and OTS, General Purpose Facility

   Explanation: A string descriptor passed to a general library
   procedure did not contain a valid DSC$B_CLASS field.

   User Action: Locate the call to the library that caused the error,
   and initialize the field to the proper class of descriptor. Refer
   to the VMS Run-Time Library Routines Volume for a description of
   the classes of descriptors.

INVSTRLEV

invalid structure level

   Facility: SMB, Symbiont Services

   Explanation: An invalid structure level is returned by the
   SMB$INITIALIZE routine. This is a fatal return status.

   User Action: Specify a valid structure level not greater than
   SMBMSG$K_STRUCTURE_LEVEL.

INVSTRUCT

invalid structure level in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the structure level
   field of a save set block. Data in the save set is corrupted.

   User Action: None. Save set data is lost.

INVSYMNAM

invalid symbol name

   Facility: LIB, Library Facility

   Explanation: The length of the specified symbol is greater than
   255 characters or the symbol did not begin with a letter.

   User Action: Do not specify a symbol name with more than 255
   characters. Ensure that all symbol names begin with letters.

INVTAB

command tables have invalid format-see documentation

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An unrecognizable command table format is encountered
   while attempting to automatically upgrade old command tables to
   the current format.

   User Action: Use the Command Definition Utility command SET
   COMMAND to re-create the tables.

INVTABSPEC

tabs specification incorrect, not changed

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Your argument to the built-in procedure SET (TAB_
   STOPS) is invalid. You must specify an integer value between 1
   and 65535, or a string consisting of only spaces and integers. If
   you specify a string, then the integers must be given in ascending
   order to achieve predictable behavior.

   User Action: Correct your argument with the built-in procedure SET
   (TAB_STOPS).

INVTERTAB

invalid terminal table

   Facility: SMG, Screen Management Facility

   Explanation: An invalid terminal table address is specified.

   User Action: Make sure you are passing the terminal table argument
   by reference and not by value. Make sure the terminal table
   address is acquired by calling SMG$INIT_TERM_TABLE.

INVTIME

invalid time interval

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An invalid time interval was specified.

   User Action: Correct the specified time interval.

INVTOKEN

unrecognized token 'symbol-name'

   Facility: PATCH, Patch Utility

   Explanation: The symbol you specified is not recognized as a valid
   PATCH command name or qualifier.

   User Action: Specify valid symbol and retry.

INVTQEFMT

invalid time queue entry format

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

INVTYPE

built-in type 'type-name' is not defined

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an invalid keyword in a built-in
   definition while reading from a CLD file.

   User Action: Edit the CLD file so that all built-in keywords are
   defined.

invalid LIB$TPARSE state table entry

   Facility: LIB, Library Facility

   Explanation: The state table passed to the LIB$TPARSE procedure is
   invalid and could not be processed.

   User Action: Correct the format of the state table in your
   program. Refer to the VMS Run-Time Library Routines Volume for
   the correct format.


INVUIC

invalid UIC

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: An invalid UIC is entered. Either the format is bad
   or an alphanumeric UIC does not have a numeric equivalent.

   User Action: Enter a valid UIC. See the VMS DCL Concepts Manual.

invalid UIC-must be of the form [group,member]

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The command contains an invalid UIC. The group and
   member portions of a UIC must be specified within square brackets
   [] and must be separated by a comma.

   User Action: Correct the UIC and reenter the command.

invalid UIC specified

   Facility: SMI, System Management Intergator/Server

   Explanation: A UIC is nonexistent or has an invalid format.

   User Action: Respecify the associated SYSMAN command with a valid
   UIC.

'UIC' is an invalid UIC specification

   Facility: RUN, Run Detached Utility

   Explanation: UIC value specified with the /UIC qualifier is
   invalid.

   User Action: Enter a valid UIC.




INVUSER

invalid user name 'name'

   Facility: INPSMB, Input Symbiont

   Explanation: The specified user name is syntactically invalid.

   User Action: Correct the error and reenter the job.

INVUSERNAME

user name syntax error

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You specified an incorrect user name.

   User Action: Enter a user name specifying a string of 1 through 12
   alphanumeric characters, underscores, wildcard characters (dollar
   signs are permissible, but usually reserved for system names), or
   a UIC.

INVUSERSPEC

error in user specification

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Your command included an incorrect user
   specification. In a user specification, you may use a numeric
   UIC format (for example, [007,007]), an alphanumeric format (for
   example, [COMPOSERS,HAYDN]), or a user name (for example, HAYDN).
   You can use wildcards to specify multiple users. Refer to the VMS
   Authorize Utility Manual for specific syntax rules for the command
   you are using.

   User Action: Correct the user specification and reenter your
   command.

INVVAL

unrecognized value

   Facility: NCP, Network Control ProgramandREM, Set Host Facility

   Explanation: A value entered for a parameter is invalid.

   User Action: Check the rules for the parameter value and reenter
   the command.

INVVALCLAUSE

invalid value clause encountered

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a invalid VALUE keyword while reading
   from a CLD file.

   User Action: Edit the CLD file so that all VALUE keywords are
   valid.

INVVEC

invalid or unspecified interrupt vector

   Facility: SYSGEN, System Generation Utility

   Explanation: Either no interrupt vector is specified in a SYSGEN
   command CONNECT, or the one that is specified is not within the
   UNIBUS interrupt vector address range.

   User Action: Reenter the command specifying a valid vector number.

INVVIEWSP

invalid /VIEWING_TIME specification

   Facility: MONITOR, Monitor Utility

   Explanation: The /VIEWING_TIME value must be an unsigned
   contiguous string of decimal digits forming a value in the range
   of 1 to 9,999,999 inclusive.

   User Action: Reenter the MONITOR request, specifying a valid
   /VIEWING_TIME value.

INVVMSOSC

invalid VMS operating system command in record "record number"

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont format
   routine indicating invalid VMS operating system command in record.

   User Action: Please submit a Software Performance Report (SPR).

INVVOI_ID

invalid voice-id

   Facility: DTK, DECtalk Facility

   Explanation: An invalid voice identifier is specified.

   User Action: Ensure that you are passing the voice identifier
   by reference, not by value. Ensure that the voice identifier is
   previously set up by a call to DTK$INITIALIZE.

INVVOLFMT

volume format specified is not consistent with file spec

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered a /VOLUME_FORMAT
   qualifier which did not make sense for the volume type implied by
   the file specification.

   User Action: It is very seldom necessary to use a /VOLUME_FORMAT
   qualifier, since the defaults taken by EXCHANGE are usually
   correct. Either leave the /VOLUME_FORMAT off, or use the correct
   option.

INVWIDARG

width of 0 is not permitted

   Facility: SMG, Screen Management Facility

   Explanation: An attempt is made to change the characteristics of
   the terminal, setting its width to 0.

   User Action: Correct the code. A width of 0 is invalid.

IO_CONCLO

I/O continued to closed file

   Facility: OTS, General Purpose Facility

   Explanation: An attempt is made to perform I/O to a file being
   closed. This error can occur only at AST level.

   User Action: Correct the program so that AST level routines do not
   perform I/O on files which may be closing.

IOERROR

I/O error initializing volume on 'device-name'

   Facility: INIT, INITIALIZE Command

   Explanation: The operator requested a volume initialization. An
   I/O error occurred during the write process.

   User Action: Attempt to perform the operation again using another
   volume. Dump the error log to determine whether a hardware error
   occurred.

IOP

operation invalid for file organization or device

   Facility: RMS, VMS Record Management Services

   Explanation: An invalid VMS RMS operation is attempted. This error
   can be caused by any of the following conditions:

   o  An attempt to perform block I/O when block I/O access is not
      specified

   o  An attempt to perform record I/O when record I/O access is not
      specified

   o  An attempt to rewind a process-permanent file

   o  An operation not valid for the device type (for example, a
      rewind request on a line printer) or the file organization (for
      example, an erase or extend request for a magnetic tape file)

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. If necessary, modify your program to detect and respond
   to the condition.

IRC

illegal record encountered; VBN or record number STV = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The byte count field or the control byte for a record
   in a file is invalid. For sequential and indexed files, the status
   value (STV) field contains the virtual block number of the block
   containing the record. For relative files, the status value (STV)
   field contains the record number of the corrupted record.

   User Action: For sequential and indexed files, try to re-create
   the rest of the file. For relative files, reinsert the bad record
   with the $PUT service using the UIF option in the ROP parameter.

   This error is caused by hardware errors, VMS RMS or system
   software errors, or inadvertent modification of files by non-RMS
   programs.

ISD_OFF

image section descriptor offset is invalid

   Facility: IMGACT, Image Activator

   Explanation: The offset in an image header block points beyond the
   end of that block. This usually indicates a corrupted or invalid
   image.

   User Action: Relink the image.

ISD_SIZ

image section descriptor length is invalid

   Facility: IMGACT, Image Activator

   Explanation: The length field of an ISD is invalid. This usually
   indicates a corrupted or invalid image.

   User Action: Relink the image.

ISD_VBN

ISD VBN greater than header block count

   Facility: IMGACT, Image Activator

   Explanation: The list of ISDs has extended to a block beyond
   the maximum number of blocks allocated to the image header. This
   usually indicates a corrupted or invalid image.

   User Action: Relink the image.

ISI

invalid internal stream identifier (ISI) value

   Facility: RMS, VMS Record Management Services

   Explanation: The internal stream identifier of the RAB does not
   specify a valid stream.

   User Action: This error usually indicates that the stream has not
   been connected; or that the RAB is inadvertently altered.

ISQUAL

qualifier required; not found

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The CREATE, GRANT or REVOKE command is given without
   its required qualifier.

   User Action: Respecify the command with the required qualifier,
   for example, GRANT/IDENTIFIER.

ITC

index entry too complicated or long

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The entry exceeds the limit of the index buffer for a
   single item.

   User Action: Reduce the length of the index entry.

ITD

.IF commands nested too deep: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The number of nested conditional commands (.IF,
   .IFNOT) exceeds the maximum limit of 10.

   User Action: Reduce the number of conditional commands.

ITEMNOTFOUND

requested item cannot be returned

   Facility: SYSTEM, VMS System Services

   Explanation: The parameter specified in the item list cannot be
   found.

   User Action: Verify the parameter specified and correct.

ITERATION

have completed iteration xxx of the VAX Vectors support device test

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test has completed xxx
   repetitions of the vector processor device test.

   User Action: None.

ITMNOTDEF

item requested with the /ITEM qualifier not defined for this
revision level

   Facility: MONITOR, Monitor Utility

   Explanation: At least one of the items requested with the /ITEM
   qualifier is not defined. For a playback request, this situation
   can occur if the file being played back is recorded by MONITOR
   in a previous version of VMS. For that version, the item may not
   have been defined. For a live request, the item may no longer be
   defined for the current revision of VMS.

   User Action: Reenter the MONITOR command, requesting only those
   items that were defined when the input file is recorded or, for a
   live request, are currently defined. As an alternative, specify
   the /ITEM=all qualifier to obtain all items available in the file
   for the requested class.

IVADDID

system # 'id-number' cannot be added to the display

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: Information for the system identified by the system
   ID number entered is not available, or the system ID number
   entered is not the system ID of a node which is previously removed
   from the display using the REMOVE SYSTEM/ID=system-id command.

   It should be noted that the system ID number must match the ID
   number in the SYS_ID field and that it must be entered in the
   same radix as that of the SYS_ID field. For more information about
   changing the radix of a field, enter the HELP SET field/FORMAT.

   User Action: Verify that the system ID entered is correct and
   reenter the command with the correct system ID, or enter the INIT
   command to initialize the display and restore all nodes to the
   display. If the system ID is correct, then be sure to remove the
   node from the display before attempting to add it to the display.

IVADDNODE

node 'node-name' cannot be added to the display

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: Information for the system identified by the node
   name entered is not available, or the node name entered is not the
   name of a node which is previously removed from the display using
   the REMOVE SYSTEM/NODE=node-name command.

   User Action: Verify that the node name entered is correct and
   reenter the command with the correct node name, or enter the INIT
   command to initialize the display and restore all nodes to the
   display. If the node name is correct, then be sure to remove the
   node from the display before attempting to add it to the display.

IVADDR

invalid media address

   Facility: SYSTEM, VMS System Services

   Explanation: A disk address specified in a physical disk read or
   write operation is not valid. This error occurs for physical read
   and write operations or as a result of a hardware error.

   User Action: Verify the disk address specified and update the
   program.

IVATIME

invalid absolute time-use DD-MMM-YYYY:HH:MM:SS.CC format

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified absolute time is in an incorrect
   format.

   User Action: Reenter the time in the format shown in the error
   message.

IVBAKADIO

invalid backing store address for I/O

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

IVBLKENT

invalid bad block specifier in string 'string'

   Facility: BAD, Bad Block Locator Utility

   Explanation: The block, as specified, contains an invalid
   character.

   User Action: Correct the value in the given field.

IVBLKNUM

'string' is an invalid block number, 'position' value 'nnnnnnnn' is
out of range

   Facility: BAD, Bad Block Locator Utility

   Explanation: The block number as specified is invalid due to the
   value in the 'position' field.

   User Action: Correct the value in the given field.

IVBUFLEN

disk boot driver invalid buffer

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: An internal MSCP error occurred.

   User Action: Submit a Software Performance Report (SPR).

invalid buffer length

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: The exact meaning of this message depends on the
   device.

   If the device is an LPA11-K and if this error occurs for an
   initialize LPA11-K request, the initialize command table length is
   not the required 278 bytes. If this error occurs for a start data
   transfer request, there are several possible causes:

   o  Command table length is not the required 40 bytes.

   o  Buffer area size is not evenly divisible by the number of
      buffers assigned.

   o  Individual buffer size is 0.

   o  Individual buffer size is not a multiple of 2 for a
      multirequest mode request, or is not 4 for a dedicated mode
      request.

   o  Random Channel List length is 0 or not a multiple of 2.

   o  Bit 15 in the last word of the Random Channel List is not set.

   If the device is a DR32 interface, the command block size or the
   buffer block size is zero or equal to or greater than 2**29, or
   the command table length is not XF$K_CMT_LENGTH.

   If this error was returned by the Pseudo Terminal Facility, it
   inidcates that the buffer size supplied is illegal. This is
   returned if the buffer size is less than 0 or greater than 508
   characters.

   User Action: Action depends on the type of device to which the I/O
   request is directed. Refer to the VMS I/O User's Reference Volume
   for additional information.

   If the error was returned by the Pseudo Terminal Facility, check
   the buffer size.


IVCHAN

invalid I/O channel

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: The channel number specified in an input or output
   request is not a valid channel number; the I/O operation cannot be
   performed.

   User Action: Check for a programming error. Verify that the
   request to assign the I/O channel completed successfully and
   returned a valid channel number.

IVCHAR

invalid numeric value-check for invalid digits

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The command interpreter encountered a character
   string in a context where it expected a numeric value (as the
   object of an arithmetic operation in an expression, or following a
   qualifier that requires a numeric value.)

   User Action: Examine the command string for an undefined or
   incorrectly spelled symbol name, a missing radix operator (for
   example, %X) preceding a hexadecimal or octal value, an invalid
   value following a radix operator (for example, %O9), or for a
   syntax error. Reenter the command.

IVCHNLSEC

invalid channel for create and map section

   Facility: SYSTEM, VMS System Services

   Explanation: The channel number specified in a request to create
   and/or map a section file is busy; the section cannot be mapped.

   User Action: Verify that the $OPEN request (to open the section
   file) completed successfully and returned a valid channel number.

IVCMD

invalid command

   Facility: LATCP, LAT Control Program

   Explanation: The LATCP detected a command syntax error.

   User Action: Enter a valid command.

IVDEV

invalid node or device name

   Facility: LATCP, LAT Control Program

   Explanation: An invalid LAT device or node name is specified
   with the CREATE or SHOW command, or an invalid or nonexistent
   LAT device name is specified with the SET command.

   User Action: Verify the node or device name, and reenter the
   command.

IVDEVNAM

invalid device name

   Facility: SYSTEM, VMS System Services

   Explanation: A device name contains invalid characters, no device
   is specified, or a command or program accepts only certain types
   of devices in a particular context.

   User Action: Verify that the device name is specified correctly
   and is suitable for the requested operation. If a logical name is
   used, verify that it has been assigned a proper equivalence name.

IVDTIME

invalid delta time-use DDDD-HH:MM:SS.CC

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified delta time is in an incorrect format.

   User Action: Reenter the delta time in the format shown in the
   error message.

IVFNAM

invalid lexical function name-check validity and spelling

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command contains the character string F$name()
   where name is not a valid function.

   User Action: Verify the spelling of the lexical function. Use the
   DCL command HELP or refer to the VMS DCL Dictionary for a list of
   lexical functions.

IVGBLTYP

invalid global master PTE type

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

IVGSDNAM

invalid global section name

   Facility: SYSTEM, VMS System Services

   Explanation: An invalid global section name is specified.

   User Action: Refer to the VMS System Services Reference Manual for
   global section name requirements.

IVKEYNAM

unrecognized key name-check validity and spelling

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You specified a key name incorrectly.

   User Action: Correct the spelling of the key name.

IVKEYW

unrecognized keyword-check validity and spelling

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A keyword specified in a command is not valid for the
   command.

   User Action: The rejected portion of the command is displayed
   between backslashes. Use the DCL command HELP or refer to the VMS
   DCL Dictionary for a list of valid keywords.

IVLISTK

interrupt stack invalid restart

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

IVLOCKID

invalid lock id

   Facility: SYSTEM, VMS System Services

   Explanation: The lock identification specified in a system
   service request (for example, $ENQ or $DEQ) is not a valid lock
   identification for that process.

   User Action: Check for a programming error. Verify that the $ENQ
   system service request, which returned the lock identification,
   completed successfully.

IVLOGNAM

invalid logical name

   Facility: SYSTEM, VMS System Services

   Explanation: A name string exceeds the maximum length permitted,
   or has a length of zero, or is longer than the specified maximum
   length logical name string, table name string, or equivalence
   string. Logical names are limited to a length of 255 characters;
   global section names are limited to 63 characters; common
   event flag, process names, and cluster names are limited to 15
   characters. An error can be returned when a name table is defined
   and the name for the new name table contains invalid characters.

   User Action: If the error occurs during command processing, verify
   the command. If the error occurs during execution of a program,
   check that the character string descriptors pointing to name
   strings indicate the correct lengths.

IVLOGTAB

invalid logical name table number

   Facility: SYSTEM, VMS System Services

   Explanation: A create or delete logical name system service
   request specified a logical name table number that is not 0
   (system), 1 (group), or 2 (process).

   User Action: Check for a programming error. Verify that the
   logical name table number is 0, 1, or 2.

IVLVEC

section not installed with privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A shareable image has not been installed with
   privilege.

   User Action: All privileged, shareable images, that is, those
   images that contain user-written system service vectors, must be
   installed using the /PROTECT qualifier.

IVMODE

invalid mode for requested function

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with a status code
   returned by an initialize LPA11-K request. The first three bits
   (2:0) of the first word (mode word) in the command table are not
   0.

   User Action: Correct the LPA11-K command table.

IVOPER

unrecognized operator in expression-check spelling and syntax

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An arithmetic expression contains a period (.),
   indicating a logical, arithmetic, or string operator, but the
   operator is not a recognized operator. The rejected portion of the
   command is displayed between backslashes.

   User Action: Correct the command. Enter the DCL command HELP
   EXPRESSIONS for a list of valid operators or refer to the VMS
   DCL Dictionary.

IVORDER

order of ACEs being modified is incorrect for object

   Facility: SET, SET Facility

   Explanation: The order of the ACEs being replaced is incorrect.

   User Action: Verify the order of the ACEs being replaced with the
   DIRECTORY/ACL command or the DCL SHOW ACL command.

IVPFAIL

the IVP for 'product' has failed.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The installation verification procedure (IVP) for the
   specified product failed.

   User Action: If you can resolve the problem, reinstall the
   product. Otherwise, contact your DIGITAL field service
   representative.

IVPROT

invalid protection code only use combinations of R,W,E, and D

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The protection code specified for a file or volume is
   not in the correct syntax.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary, if necessary, for the correct syntax and reenter the
   command.

IVPROTECT

invalid page protection code

   Facility: SYSTEM, VMS System Services

   Explanation: A page protection code is specified as 1 or is
   greater than 15.

   User Action: Check for a programming error.

IVQLOC

invalid qualifier location-place after a parameter

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A qualifier that can be used only to qualify a
   parameter value in a command is placed following the command name.

   User Action: Reenter the command; place the qualifier following
   the parameter value it actually qualifies. Use the DCL command
   HELP or refer to the VMS DCL Dictionary to determine the meaning
   and placement of the qualifier.

IVQUAL

invalid qualifier name

   Facility: INSTALL, Install Utility

   Explanation: An invalid qualifier is specified.

   User Action: Reenter the command line.

unrecognized qualifier-check validity, spelling, and placement

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The qualifier is spelled incorrectly or is improperly
   placed in the command line.

   User Action: Correct the command line.

value for qualifier 'name' is invalid as 'number'

   Facility: LATCP, LAT Control Program

   Explanation: The value 'number' for the qualifier 'name' of a SET
   command is invalid or out of range.

   User Action: Reenter the command with a valid value.



IVQUOTAL

invalid quota list

   Facility: SYSTEM, VMS System Services

   Explanation: The quota list specified for a Create Process system
   service is not in the proper format, or it contained invalid quota
   names.

   User Action: Check for a programming error. Verify that the call
   to the service is programmed correctly. Refer to the VMS System
   Services Reference Manual for programming specifications.

IVREMID

system # 'id-number' cannot be removed from the display

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The system ID number entered is not the system ID
   number of a node which is currently being displayed.

   User Action: Verify that the SYS_ID field in the SYSTEMS class is
   being displayed and if not, display the SYS_ID field by entering
   in the command ADD SYS_ID.

   Verify that the system ID entered is one of the system IDs being
   displayed in the SYS_ID field.

IVREMNODE

node 'node-name' cannot be removed from the display

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The node name entered is not the name of a node which
   is currently being displayed.

   User Action: Verify that the NODE field in the SYSTEMS class is
   being displayed and if not, display the NODE field by entering in
   the command ADD NODE. Verify that the node name entered is one of
   the node names being displayed in the NODE field.

IVS

illegal /VARIANT qualifier

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The name specification for conditional commands is
   invalid.

   User Action: Correct the name specification.

IVSECFLG

invalid process/global section flags

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: Flags specified as input arguments to a system
   service were not valid.

   User Action: Verify that the call to the service is coded
   correctly. See the VMS System Services Reference Manual for coding
   specifications.

IVSECIDCTL

invalid section identification match control

   Facility: SYSTEM, VMS System Services

   Explanation: The match control field in the section identification
   argument to identify a global section contains an invalid number.

   User Action: Verify that the call to the service is coded
   correctly. See the VMS System Services Reference Manual for coding
   specifications.

IVSSRQ

invalid system service request

   Facility: SYSTEM, VMS System Services

   Explanation: A call is made to a service that does not exist.

   User Action: Check for a programming error.

IVSSRVRQST

invalid system service request

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

IVSTSFLG

invalid status flag

   Facility: SYSTEM, VMS System Services

   Explanation: If the Create Process system service ($CREPRC) is
   called, this message indicates that a reserved bit is set in a
   status flag argument. If the Create Mailbox and Assign Channel
   system service ($CREMBX) is called, this message indicates that
   the prmflg byte is not set correctly.

   User Action: If $CREPRC is called, verify that the call is coded
   correctly. Refer to the VMS System Services Reference Manual
   for coding specifications. If $CREMBX is called, set the prmflg
   argument to either 1 or 0.

IVSYMB

invalid symbol name-start with an alphabetic character

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An assignment statement specified a symbol name that
   does not begin with an alphabetic character.

   User Action: Choose a name for the symbol that begins with one of
   the letters A through Z and reenter the command.

IVTIME

invalid time

   Facility: SYSTEM, VMS System Services

   Explanation: A time value specified in a system service call is
   invalid. Either a delta time is greater than 10,000 days, or a
   calculated absolute time is less than the system date and time.

   User Action: Check for a programming error. Verify that the call
   to the service is coded correctly.

invalid time passed in, or computed

   Facility: LIB, Library Facility

   Explanation: The value of an argument is out of range, or the
   computed delta time is out of range.

   User Action: Examine each argument. Determine which one is out of
   range or is causing the computed delta time to be out of range,
   and correct the program.


IVTYPE

invalid system type 'system-type', -must match HW_TYPE field or ALL

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The hardware type entered is not a valid hardware
   type or information for systems of the type entered is not
   available.

   User Action: Verify that the HW_TYPE field in the SYSTEMS class
   is being displayed and if not, display the HW_TYPE field by
   entering in the command ADD HW_TYPE. If using the REMOVE SYSTEMS
   /TYPE=hardware-type command, then verify that the hardware type
   entered is one of the hardware types being displayed in the HW_
   TYPE field. If using the ADD SYSTEMS/TYPE=hardware-type command,
   then verify that the hardware type entered is one of V785, V780,
   V750, or HS50, or simply use the command ADD SYSTEM/TYPE=ALL

IVVALU

invalid value syntax-see command documentaion

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A value for a command qualifier is not specified
   correctly, or a command is not being used in its proper context.
   The rejected portion of the command is displayed between
   backslashes.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary to determine the proper syntax or use of the command.

IVVERB

unrecognized command verb-check validity and spelling

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The first word on the command is not a valid DCL
   command or a symbol name equated with a command. The rejected
   portion of the command is displayed between backslashes.

   User Action: Check the spelling of the command name or symbol name
   and reenter the command.

IVWSETLIST

invalid working set list entry

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

JBCERROR

error communicating with job controller

   Facility: SYSTEM, VMS System Services

   Explanation: An error occurred in communicating with the job
   controller while handling an implicitly spooled file.

   User Action: The file may or may not be printed. If it is not
   printed, a lost file results. The system manager should ensure
   that the job controller is functioning properly.

JBRTAINHLD

job 'job-name' for user 'username' in queue 'queue-name' has had
option retained replaced with hold

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: The status of a job has been changed from retain to
   hold.

   User Action: Contact the owner of the job to determine what
   corrective actions should be taken prior to releasing the job
   to be scheduled for execution.

JEC

Unexpected text at end of command: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: Extraneous text (not a valid terminator) follows this
   command.

   User Action: Insert a valid terminator after the command.

JNLACP

Fatal error detected by journal ACP

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

JNLACTIVE

asynchronous actions prohibited when journal file open

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Asynchronous action routines are prohibited when a
   journal file is open.

   User Action: You must choose between journaling routines and
   action routines.

JNLDRV

Fatal error detected by journal driver

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

JNLNOTAUTH

RMS Journaling not authorized; operation not performed

   Facility: RMS, VMS Record Management Services

   Explanation: An attempt was made to open a file marked for RMS
   journaling for write access on a node that is not authorized to
   perform RMS journaling. Access to the file has been denied. The
   secondary status value (STV) contains the error status from the
   License Management Utility.

   User Action: If you want to journal the file, RMS journaling
   must be authorized on the node from which you access the file.
   Either attempt to access the file on a node that is authorized to
   perform RMS journaling, or fix the error condition specified in
   the secondary status value (STV). See the VMS License Management
   Utility Manual for more information.

   If you do not want to journal the file, unmark the file for
   journaling by entering a command in the following form:

   SET FILE/NOAI_JOURNAL/NOBI_JOURNAL/NORU_JOURNAL filespec

JNLNOTOPEN

journal file not open, recovery aborted

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU is asked to recover data from a journal file,
   but the journal file was not opened.

   User Action: Modify your section file to open the journal file
   during a recovery.

JNLOPEN

journal file already open

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A journal file is already open.

   User Action: Close the current journal file before opening
   another.

JNLPUT

error writing to journal file

   Facility: PATCH, Patch Utility

   Explanation: An output error occurred while PATCH is writing to
   the journal file.

   User Action: This message is issued with accompanying messages.
   Take corrective action based on the accompanying messages.

Job 'name' (queue 'name', entry 'number') completed

   Facility: JBC, Job Controller

   Explanation: This message is issued in response to the /NOTIFY
   qualifier of the PRINT or SUBMIT command to indicate that the
   specified job has completed. If the job completed unsuccessfully,
   this message is followed by the completion status of the job. The
   message is informational.

   User Action: None.

Job 'name' (queue 'name', entry 'number') holding

   Facility: JBC, Job Controller

   Explanation: This message is issued in response to the /IDENTIFY
   qualifier of the PRINT or SUBMIT command to indicate that the
   specified job has been successfully entered on the queue listed.
   By default, this information is displayed on the current output
   device for the PRINT and SUBMIT commands. This message is
   informational.

   User Action: None.

Job 'name' (queue 'name', entry 'number') holding until 'time'

   Facility: JBC, Job Controller

   Explanation: This message is issued in response to the /IDENTIFY
   qualifier of the PRINT or SUBMIT command to indicate that the
   specified job has been successfully entered on the queue listed.
   By default, this information is displayed on the current output
   device for the PRINT and SUBMIT commands. This message is
   informational.

   User Action: None.

Job 'name' (queue 'name', entry 'number') pending

   Facility: JBC, Job Controller

   Explanation: This message is issued in response to the /IDENTIFY
   qualifier of the PRINT or SUBMIT command to indicate that the
   specified job has been successfully entered on the queue listed.
   By default, this information is displayed on the current output
   device for the PRINT and SUBMIT commands. This message is
   accompanyied by one of the following lines of text:

   o  Pending status caused by insufficient access to queue

   o  Pending status caused by characteristic mismatch

   o  Pending status caused by lowercase attribute not present on
      queue

   o  Pending status caused by job size below queues minimum job size
      limit

   o  Pending status caused by job size above queues maximum job size
      limit

   o  Pending status caused by form/stock mismatch

   o  Pending status caused by 'reason'

   This message is informational.

   User Action: None.

Job 'name' (queue 'name', entry 'number') started on 'name'

   Facility: JBC, Job Controller

   Explanation: This message is issued in response to the /IDENTIFY
   qualifier of the PRINT or SUBMIT command to indicate that the
   specified job has been successfully entered on the queue listed.
   By default, this information is displayed on the current output
   device for the PRINT and SUBMIT commands.

   User Action: This message is informational.

JOBABORT

job aborted during execution

   Facility: JBC, Job Controller

   Explanation: The execution of the affected job is aborted by a
   STOP/ABORT, STOP/ENTRY, or DELETE/ENTRY command.

   User Action: If necessary, resubmit the job.

JOBCARD

job beginning 'command'

   Facility: INPSMB, Input Symbiont

   Explanation: The system encountered an error in a batch job
   entered from a card reader. This message displays the text of
   the JOB command; it is followed by the error messages for the
   batch job.

   User Action: Take corrective action based in the accompanying
   messages.

JOBCTLABORT

request failed because job controller aborted

   Facility: JBC, Job Controller

   Explanation: The $GETQUI, $SNDACC, $SNDJBC, or $SNDSMB system
   service operation failed because the job controller process
   terminated execution. The job controller voluntarily aborts
   and restarts itself if it encounters a fatal system error or an
   internal logic error.

   User Action: None.

JOBDELETE

job deleted before execution

   Facility: JBC, Job Controller

   Explanation: The affected job was deleted by a DELETE/ENTRY or
   DELETE/QUEUE command before it executed.

   User Action: If necessary, resubmit the job.

JOBQUEDIS

system job queue manager is not running

   Facility: JBC, Job Controller

   Explanation: The requested operation cannot be executed because
   the system job queue manager has not been started. This error
   is returned on queue operations before the START/QUEUE/MANAGER
   command has been executed.

   User Action: Consult the system manager.

JOBQUEENA

system job queue manager is already running

   Facility: JBC, Job Controller

   Explanation: The system job queue manager cannot be started
   because it is already running. This error is returned in response
   to the START/QUEUE/MANAGER command when the queue manager has been
   previously started.

   User Action: If the system job queue manager must be restarted
   to specify different queue file parameters, first issue the STOP
   /QUEUE/MANAGER command. Otherwise, no action is necessary.

JOBREQUEUE

job aborted during execution and then requeued

   Facility: JBC, Job Controller

   Explanation: The execution of the affected job is aborted by a
   STOP/REQUEUE command. The job is requeued and will be executed
   again.

   User Action: None.

Journal file could not be closed

   Facility: EDT, EDT Editor

   Explanation: You used the /RECOVER qualifier in your EDIT/EDT
   command line, but EDT is unable to close the journal file after
   processing the commands in it. Some problem exists at the system
   level with that file.

   User Action: Correct the problem indicated by the file system
   message.

Journal file could not be opened

   Facility: EDT, EDT Editor

   Explanation: The journal file given in the command line cannot be
   opened. EDT will display an associated file system message for the
   error.

   User Action: Correct the problem indicated by the file system
   message.

JOURNAL

journaling to 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility is writing journal records to the
   specified file in response to the /JOURNAL qualifier. This message
   is displayed only if the /LOG qualifier is specified.

   User Action: None.

JOURNALBEG

Journal of edit session started

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The journaling of your VAXTPU session has begun.

   User Action: None is required. However, you may execute the built-
   in procedure JOURNAL_CLOSE if you want to close the journal file.

JOURNALCLOSE

Journal file successfully closed, journaling stopped

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedure JOURNAL_CLOSE has closed the
   journal file. Your subsequent commands will not be written to the
   journal file.

   User Action: None.

JOURNALEOF

End of journal file found unexpectedly

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Journal recovery is aborted due to an unexpected end
   of file.

   User Action: If the recovered information is sufficient, resume
   editing from this point. VAXTPU has recovered as much as it can
   from your journal file.

JPITSTERR

error encountered while testing $GETJPI system service

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   testing VMS system services. This error is received in relation to
   a previously displayed error condition or could be the result of a
   more serious VMS problem.

   User Action: If a condition is identified which is causing the
   problem, correction the condition and re-run the test. If the
   error persists, submit a Software Performance Report. If no
   condition can be identified, run diagnostics for VAX Vectors,
   or contact Digital customer service.

KBF

invalid key buffer

   Facility: RMS, VMS Record Management Services

   Explanation: The specified key buffer is in an area of memory that
   cannot be correctly accessed by the caller.

   User Action: Verify that the call to the VMS RMS service is
   programmed correctly. Specifically, check that the key buffer
   address is correctly specified.

KEY

invalid record key

   Facility: CONVERT, Convert Utility

   Explanation: You have specified a key of the wrong data type.

   User Action: Supply a key with the correct data type.

invalid record number key or key value

   Facility: RMS, VMS Record Management Services

   Explanation: An invalid key value is specified in one of the
   following ways:

   o  A negative or zero record number is specified for a random
      operation on a sequential or relative file.

   o  A packed decimal key value specified for an indexed value
      contained an invalid nibble.

   User Action: Modify the program, if necessary, to detect and
   respond to the condition.


KEYALRINS

key already inserted in tree

   Facility: LIB, Library Facility

   Explanation: A key is found in the tree, so a new key is not
   inserted.

   User Action: None. The operation is successful.

KEYAMBINC

key specification is ambiguous or inconsistent

   Facility: SORT, Sort/Merge Utility

   Explanation: You specified duplicate key parameters for a single
   /KEY qualifier.

   User Action: Specify each key parameter only once. For multiple
   keys, use a /KEY qualifier for each key.

KEYCNV

synonym 'key name' has been converted to 'key name'

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This informational message signifies that the key
   name specified in the DEFINE/KEY command is a synonym for a
   definable key name. The synonym name is converted to the actual
   key name prior to defining the key.

   User Action: None.

KEYDEFPRO

key definition is protected-cannot be changed or deleted

   Facility: SMG, Screen Management Facility

   Explanation: The specified key is already defined, and since its
   definition is protected, it cannot be changed or redefined.

   User Action: None.

KEYED

mismatch between sort/merge keys and primary file key

   Facility: SORT, Sort/Merge Utility

   Explanation: You created an empty indexed file with a primary
   key that does not match the sort key. The sort operation is less
   efficient than it is when the two keys match.

   User Action: For greater efficiency, create a new indexed file or
   change your sort key.

KEY_LEN

invalid key length, key number n, length n

   Facility: SORT, Sort/Merge Utility

   Explanation: The key size is incorrect for the data type, or the
   total key size is greater than 32,767.

   User Action: Specify the correct key field size. Size must be less
   than or equal to 32,767 for character data; 1, 2, 4, 8, or 16 for
   binary data; and less than or equal to 31 for decimal. Also, only
   ascending or descending order is allowed.

KEYMAPNOTFND

key map 'key-map-name' not found in key-map list 'key-map-list-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are trying to remove a key map that is not in the
   key-map list.

   User Action: Enter the built-in procedure SHOW (KEY_MAP_LISTS)
   on the command line to obtain the names of the key maps in your
   key-map list.

KEYNAMLNG

key 'key-name' name length illegal in library 'filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The name of the module you are inserting exceeds the
   name length limit for the library.

   User Action: Rename the module before inserting it into the
   library.

KEYNOTDEF

key is not defined

   Facility: SMG, Screen Management Facility

   Explanation: An attempt is made to perform an operaton, such as
   SMG$GET_KEY_DEF, on a key which is not defined.

   User Action: Check your program to see if this key should have
   been defined.

KEYNOTFND

key not found

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. The Librarian could not find the key you specified in
   the key name argument to the LBR$LOOKUP_KEY routine.

   User Action: Correct the key name argument before calling the
   routine.

KEYNOTFOU

key not found in tree

   Facility: LIB, Library Facility

   Explanation: The specified key is not found in the tree.

   User Action: Take appropriate action.

Keys cannot be defined in Nokeypad mode

   Facility: EDT, EDT Editor

   Explanation: The nokeypad DEFK command can reassign the key
   definition function only in keypad mode to a key other than
   CTRL/K. It cannot be used to redefine keys. The attempted
   operation cannot be performed.

   User Action: None.

KEYSUPERSEDED

definition of key 'name' superseded

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The key you are defining is already defined. The new
   definition, which you supplied, will replace the old one.

   User Action: None.

KEYWORDPARAM

keyword 'name' used as procedure, variable, or constant

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A keyword is being used as a user-defined procedure
   variable or constant.

   User Action: Use a name that is not a keyword and recompile your
   program.

KFF

known file found

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS request to search the known file list
   completed successfully, and the RMS file open is not required.

   User Action: None. This message is provided for DIGITAL-supplied
   component usage.

KNM

key name buffer not accessible for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The key name buffer address in a key definition XAB
   specifies an area of memory that cannot be correctly accessed by
   the caller.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly; in particular, verify that the
   buffer is readable for a $CREATE operation, and writeable for a
   $DISPLAY or $OPEN operation.

KRF

invalid key-of-reference for $GET/$FIND

   Facility: RMS, VMS Record Management Services

   Explanation: The key-of-reference value specified in the RAB is
   greater than the number of keys defined for the file.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

KRNLSTAKNV

kernel stack not valid

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

KSI

index bucket will not hold two keys for key-of-reference = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The size of the index buckets specified for the key
   must be large enough to hold at least two key values.

   User Action: The status code (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the VMS RMS
   service is coded correctly.

KSZ

invalid key size for $GET/$FIND

   Facility: RMS, VMS Record Management Services

   Explanation: The key size specified for a relative or sequential
   file does not specify a length of four bytes. Or the key size
   specified for an indexed file is greater than the key length or is
   zero for a string key.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

LABELERR

error in tape label processing on 'save-set-spec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to process the file labels on the specified volume. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

LAN

invalid lowest-level-index area number for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The lowest-level-index area number specified in a key
   definition XAB is not a defined area for the file.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

LARGECNT

'device-name' is too large to be processed

   Facility: BACKUP, Backup Utility

   Explanation: The specified volume is too large to be processed by
   the Backup Utility. The error may be caused because the specified
   cluster factor is too small.

   User Action: Retry the operation using a larger volume cluster
   factor.

disk too large to be supported

   Facility: INIT, INITIALIZE Command

   Explanation: This version of Files-11 does not support a disk of
   this size.

   User Action: Check the device driver to determine if it is
   initializing the device database correctly. You may have a need
   for DIGITAL-supplied custom software.


LASTCHANCE

stack exception handlers lost, reinitializing stack

   Facility: DEBUG, VMS Debugger

   Explanation: The applications program contained an error that
   caused the exception handling mechanism to fail. This error occurs
   when the stack is overwitten by the applications program or by
   deposit commands.

   User Action: Identify and correct the error in the application
   program.

LCKPAGFUL

no more pages may be locked in memory

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt to lock pages in memory failed because the
   system limit for the number of locked pages is reached.

   User Action: See your system manager. If some pages were
   successfully locked, unlock them and attempt to load the new
   pages.

LDE

literal doesn't end with .END LITERAL: 'STRING'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A DSR command .END LITERAL does not immediately
   follow the final line of a DSR command .LITERAL n (where n is
   the number of lines to be produced).

   User Action: Put the DSR command .LITERAL on the correct line,
   recount the number of lines of literal text and reset n, or remove
   the n value.

LENMUSONE

length of fill string and clear string must be 1

   Facility: SMG, Screen Management Facility

   Explanation: A call to SMG$READ_VERIFY specified a fill string or
   a clear string more than 1 character long. Since fill character
   matching is done one character at a time, only one character may
   be specified for the fill and clear string.

   User Action: Modify the fill string or the clear string, or both,
   to be 1 character long.

LENNOTEQL

length of picture string and initial string are not equal

   Facility: SMG, Screen Management Facility

   Explanation: A call to SMG$READ_VERIFY specified a picture string
   and an initial string of unequal lengths. Since the initial string
   is used as the default value for the input, it must match the
   picture string in length.

   User Action: Modify the initial string so that is is the same
   length as the picture string.

LENVIO

address space length violation

   Facility: SYSTEM, VMS System Services

   Explanation: A virtual address specified in a system service call
   is beyond the end of the process's program or control region.

   User Action: Check for a programming error. Verify that the call
   to the service is coded correctly.

LEX

invalid $EXTEND for area 'nnn' containing an unused extent

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $EXTEND operation attempted to extend the
   specified area, and an unused extent is already allocated. Each
   area has, at most, one current extent and one unused next extent.

   User Action: The status value (STV) field of the FAB contains the
   area number in error. Verify that the call to the VMS RMS service
   is coded correctly.

LIBFIND

failed to find valid module or STB at RFA 'number:number' for module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The linker tried to read the stated object module
   at the specified Record File Address, but did not find a valid
   module. This is generally due to someone deleting a module out of
   a library between Pass 1 and Pass 2.

   User Action: Retry the link operation. If it continues to fail
   with the same error, try rebuilding the library.

LIBNAMLNG

library module name 'module-name' has illegal length ('decimal-
number')

   Facility: LINK, Linker Utility

   Explanation: A library module name specified in the /INCLUDE
   qualifier has illegal length.

   User Action: Reenter the command correctly.

LIBNOTOPN

library not open

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. Except for LBR$INI_CONTROL and LBR$OPEN, all routines
   require that the library be open.

   User Action: Open the library before calling the routine.

LIBOPN

library already open

   Facility: LBR, Librarian Subroutine Package

   Explanation: This warning message is generated by the Librarian
   routines. The library you attempted to open is already open.
   Processing of your program continues.

   User Action: None.

LINCOM

line communication error

   Facility: NCP, Network Control Program

   Explanation: The requested line is unavailable, or an error
   occurred during transmission to the line. For example, this error
   occurs if the line identifier is incorrect.

   User Action: Make sure that you are correctly identifying the
   line, and that the line is in the correct state for the function
   you are performing.

LINEABRT

host aborted transmission or failed to respond

   Facility: SYSTEM, VMS System Services

   Explanation: The IBM host either aborted the current transmission
   with a protocol sequence (EOT) or failed to respond to an
   emulator-generated ENQ. In the latter case, the emulator sent
   the number of ENQ sequences specified by the ENQ count in IO$_
   SETCHAR, and the IBM host did not issue an appropriate response.

   User Action: Retry the transmission. If you continue to receive
   this message after several attempts, the line is probably
   defective and/or unusable.

Line exceeded 255 characters, truncated

   Facility: EDT, EDT Editor

   Explanation: The input for the line exceeds 255 characters; the
   excess is deleted.

   User Action: None.

LINEINFO

'line-description'

   Facility: DEBUG, VMS Debugger

   Explanation: Accompanying this message is one of the following
   lines of text:

      no line information is available
      no 'line-number', previous line is 'line-number', next line is
      'line-number'

   This message is issued when the debugger cannot associate a
   specified line number with an instruction in your program, for
   example, after an EXAMINE/SOURCE or SET BREAK command.

   User Action: Specify a line number associated with an instruction,
   for example, a routine or a label.

LINERR

command line segment in error 'text'

   Facility: LINK, Linker Utility

   Explanation: Errors were found during command line processing. The
   given segment of the command line is in error.

   User Action: Correct the error and retry the operation.

LINETOOLONG

line is maximum length, cannot add text to it

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The line in the text buffer is already at the maximum
   length allowed.

   User Action: Use the built-in procedure SHOW to find the maximum
   length and then shorten the line.

LINK

error on logical link

   Facility: CNF, NI Configurator

   Explanation: An error occurred on a logical link.

   User Action: See the accompanying message to determine the
   appropriate action.

LINKABORT

network partner aborted logical link

   Facility: SYSTEM, VMS System Services

   Explanation: The remote process disconnected the logical link
   either because the process exited prematurely or because it is the
   normal way for the process to disconnect the link.

   User Action: Check to see if the node is reachable and retry.

LINKACTIVE

link is already active

   Facility: LATCP, LAT Control Program

   Explanation: You attempted to activate a link (using the SET NODE
   or START NODE command) that is already active.

   User Action: None.

LINKDISCON

network partner disconnected logical link

   Facility: SYSTEM, VMS System Services

   Explanation: The remote process disconnected the logical link.
   This is an expected action.

   User Action: None.

LINKEXISTS

link name already exists

   Facility: LATCP, LAT Control Program

   Explanation: You attempted to create a link that you have already
   created.

   User Action: Reenter the command with a new link name.

LINKEXIT

network partner exited

   Facility: SYSTEM, VMS System Services

   Explanation: The remote process exited before confirming the
   logical link for one of the following reasons:

   o  A problem with the log file on the remote node

   o  An unopened remote log file because of a write-locked disk (on
      the remote node)

   o  A premature exit of the process

   User Action: Refer to the VMS Networking Manual. Then either read
   the remote log or retry the operation.

LINNOTFND

requested line is not found

   Facility: SMG, Screen Management Facility

   Explanation: The input line requested in a call to SMG$RETURN_
   INPUT_LINE is not found.

   User Action: If necessary, modify your program to recognize this
   condition and respond to it.

LINPRO

line protocol error

   Facility: NCP, Network Control Program

   Explanation: Indicates an invalid line protocol message or
   operation during direct line access. In the case of a line loop
   test, an error that should have been detected by the line protocol
   is detected during message comparison.

   User Action: Make sure that the line protocol and the line
   characteristics are set correctly.

LINTOOLONG

line too long

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A source line in a macro definition is longer than
   1000 characters.

   User Action: Restructure the source code so that the line is
   shorter.

LISINPSAV

the /LIST qualifier requires save set as input

   Facility: BACKUP, Backup Utility

   Explanation: The input specification for a listing operation must
   reference a save set.

   User Action: Correct the specification and reenter the command.

LISTENDSB

event listening disabled

   Facility: AUDSRV, Audit Server

   Explanation: Security audit event listening has been disabled.

   User Action: None. This is an informational message.

LISTENENAB

event listening enabled on device 'device'

   Facility: AUDSRV, Audit Server

   Explanation: The specified device has been successfully enabled as
   a security audit event listener device.

   User Action: None. This is an informational message.

LISTENFAIL

device 'device' does not exist or is not accessible; requestor PID:
'pid'

   Facility: AUDSRV, Audit Server

   Explanation: The specified listener device could not be accessed
   because the device does not exist or it is not accessible to the
   audit server process.

   User Action: Insure that the device exists and allows
   (SYSTEM:RWLP) access.

LISTENNOTMBX

requested listener device 'device' is not a mailbox; requestor PID:
'pid'

   Facility: AUDSRV, Audit Server

   Explanation: The audit server could not associate the specified
   listener device because the listener device is not a mailbox
   device.

   User Action: Specify an existing mailbox device.

LISTNOTFND

attribute name not previously defined

   Facility: CDU, Command Definition Utility

   Explanation: There is an undefined symbol reference in the syntax
   of the CLD file.

   User Action: Define the syntax list in the CLD file.

LKBGRANTED

LKB is granted, but shouldn't be

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

LKBREFNEG

LKB reference count negative

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

LKPNOTDON

lookup has not been done

   Facility: LBR, Librarian Subroutine Package

   Explanation: This error message is generated by the Librarian
   routines. LBR$LOOKUP_KEY is not called before calling up LBR$GET_
   RECORD.

   User Action: Call LBR$LOOKUP_KEY before calling LBR$GET_RECORD.

LKWSETFUL

locked portion of working set is full

   Facility: SYSTEM, VMS System Services

   Explanation: No more pages can be locked in the working set
   because there would not be enough remaining pages available
   dynamically for the image to continue execution.

   User Action: Use the DCL command SET WORKING_SET to increase the
   working set limit, if the limit is not already set at the maximum
   allowed. If the working set limit is already at the maximum
   allowed, correct the program that attempted to lock too many pages
   in the working set.

LNE

logical name translation error

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS encountered an error while translating a
   logical name. This can be an error from the following:

   o  The limit of 10 levels of logical name translation has been
      exceeded.

   o  A logical name is recursively entered in a logical name table.

   o  A logical name translates to an invalid process permanent file
      name equivalence string.

   User Action: Use the DCL command SHOW LOGICAL to verify the
   current result of translation on the specified logical name.
   Verify that the call to the VMS RMS service is coded correctly.

LNK

invalid link identification

   Facility: NCP, Network Control Program

   Explanation: The format of the link identification is incorrect.

   User Action: Check the syntax rules for link identifiers, and
   reenter your command with the correct link identifier.

LOADERR

error loading image, 'image-name'

   Facility: ERF, Error Log Utility

   Explanation: An error occurred during an attempt to load the
   specified image.

   User Action: Obtain the specified image from your distribution
   kit. If the specified image is not part of your distribution kit,
   submit a Software Performance Report (SPR).

LOADIDX

error loading secondary index n

   Facility: CONVERT, Convert Utility

   Explanation: Some error occurred during the load of the specified
   key of reference on the output file. This message will be
   accompanied by another message that will describe the error. NOTE:
   Indexes 0 through n-1 are intact.

   User Action: Correct the error described by the other message and
   try again.

LOCKED

data base locked. Try again later.

   Facility: LATCP, LAT Control Program

   Explanation: LATCP cannot run because another user is modifying
   the LATCP database.

   User Action: Wait for a while; then reenter the command. If the
   problem persists, determine who is using LATCP. Wait until that
   person is finished, or ask him or her to exit.

LOCKHEADER

file ('file-id') 'filename' deaccess locked

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified file is
   marked as deaccess locked.

   User Action: If the /CONFIRM qualifier is specified, the user may
   elect to unlock or to delete the file.

LOCKMGRERR

error detected by Lock Manager

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

LOCKVOL

error locking volume set-/REPAIR canceled

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to lock the volume set to execute a /REPAIR operation. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line. The /REPAIR qualifier
   requires a system UIC or SYSPRV privilege, or that the user be the
   owner of the volume.

LOCNEG

entity explicitly and locally negated in command string

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified qualifier is present in its negated
   form (with /NO) and is used as a local qualifier.

   User Action: None.

LOCNOTEST

lock is not established

   Facility: PPL, Parallel Processing Facility

   Explanation: You cannot release a lock you have not been granted.

   User Action: Code your program to ensure that the lock is held by
   the caller attempting to release it.

LOCPRES

entity value is locally present in command string

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified qualifier is present and is used as a
   local qualifier.

   User Action: None.

LOGCLOS

logfile closed by operator 'filespec' logfile is 'filespec'

   Facility: OPCOM, Operator Communication

   Explanation: This message indicates that OPCOM has closed the
   operator's log file.

   User Action: None.

LOGDBUR

event receiver database update at 'dd-mm-yy hh:mm:ss.ms'

   Facility: EVL, Event Logger

   Explanation: The event receiver updated its internal database as
   a result of a startup or notification from NETACP. This message
   displays the time stamp for the update. This is an informational
   message.

   User Action: None.

LOGDBUT

event transmitter database update at 'dd-mm-yy hh:mm:ss.ms'

   Facility: EVL, Event Logger

   Explanation: The event transmitter updated its internal database
   as a result of EVL startup or notification from NETACP. This
   message displays the time stamp for the update. This is an
   informational message.

   User Action: None.

LOGFAI

failed to open log file

   Facility: REM, Set Host Facility

   Explanation: An error prevented the creation of a log file. This
   message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

LOGFAIL

failed logfile operation on file 'filespec'

   Facility: OPCOM, Operator Communication

   Explanation: The DCL command REPLY/LOG failed to create a new
   operator communication log file. This message generally indicates
   a file system failure.

   User Action: Accompanying messages indicate the reason for the
   failure.

LOGIC

logic error in NCP

   Facility: NCP, Network Control Program

   Explanation: A logic error occurred in NCP.

   User Action: Submit a Software Performance Report detailing the
   command that caused this error.

program logic error or unexpected condition

   Facility: CNF, NI Configurator

   Explanation: A condition or circumstance is encountered which
   NICONFIG logic is unprepared to handle.

   User Action: This is a programming error and should be reported.

LOGIN-account is auto-login only

   Facility: LOGIN, Login Processor

   Explanation: The automatic login feature permits users to log in
   to the system without specifying a user name. An automatic login
   account cannot be accessed by a normal interactive login or by
   an explicit DECnet access control string. This message is not
   displayed to the user; it is written to the system accounting
   and security audit records. The message displayed to the user is
   "User authorization failure"; the message displayed to the system
   manager is AUTOLOGIN.

   User Action: None.

LOGIN-account is disabled

   Facility: LOGIN, Login Processor

   Explanation: An attempt is made to log in to an account when the
   account is disabled. An account's system access can be restricted
   by setting the DISUSER flag in the user authorization file. This
   message is not displayed to the user; it is written to the system
   accounting and security audit records. The message displayed to
   the user is "User authorization failure"; the message displayed to
   the system manager is DISUSER.

   User Action: None.

LOGIN-breakin evasion in effect

   Facility: LOGIN, Login Processor

   Explanation: Access to an account is denied because break-
   in evasion is in effect for that account. This message is not
   displayed to the user; it is written to the system accounting
   and security audit records. The message displayed to the user is
   "User authorization failure"; the message displayed to the system
   manager is EVADE.

   User Action: None.

LOGIN-error accessing authorization record

   Facility: LOGIN, Login Processor

   Explanation: The Login Processor could not read the specific user
   record for this user. The message displayed to the system manager
   is USERAUTH.

   User Action: Try the operation again later.

LOGIN-error accessing network authorization file

   Facility: LOGIN, Login Processor

   Explanation: LOGIN could not read the SYS$SYSTEM:NETPROXY.DAT
   network user authorization file. The message displayed to the
   system manager is NETUAFERR.

   User Action: Determine whether the file SYS$SYSTEM:NETPROXY.DAT
   exists and, if it does, make sure it is not protected against
   system read access.

LOGIN-error accessing system authorization file

   Facility: LOGIN, Login Processor

   Explanation: LOGIN could not read SYS$SYSTEM:SYSUAF.DAT. The
   message displayed to the system manager is FILEACC.

   User Action: Check to see that the file exists and that it has
   system read access.

LOGIN-error activating command interpreter 'CLI name'

   Facility: LOGIN, Login Processor

   Explanation: An error occurred when you tried to activate the
   specified command interpreter. The message displayed to the system
   manager is CLIFAIL.

   User Action: Ensure that the command interpreter image exists and
   that the image file has read access.

LOGIN-error activating command interpreter tables 'table name'

   Facility: LOGIN, Login Processor

   Explanation: LOGIN cannot access the specified command language
   interpreter tables. The message displayed to the system manager is
   CLITBLFAIL.

   User Action: Determine whether the specified tables exist and,
   if they do, make sure they are not protected against system read
   access.

LOGIN-error changing expired password

   Facility: LOGIN, Login Processor

   Explanation: An error occurred while changing an expired password.
   This message is usually accompanyied by an additional message
   describing the exact cause of the error. (This message appears as
   FRCPWDERR to the system manager.)

   User Action: Take corrective action based in the accompanying
   message.

LOGIN-error connecting to 'terminal-name'

   Facility: LOGIN, Login Processor

   Explanation: An error occurred when the system attempted to
   reconnect to the specified disconnected terminal. The message
   displayed to the system manager is CONNERR.

   User Action: Try again. If the error reoccurs, report it to your
   system manager.

LOGIN-error creating space for command interpreter symbol table

   Facility: LOGIN, Login Processor

   Explanation: There is not enough virtual address space available
   to create the command interpreter symbol table. The message
   displayed to the system manager is CLISYMTBL.

   User Action: Check that the system is set up with the value of
   VIRTUALPAGECOUNT large enough to allow the CLI to be mapped.

LOGIN-error opening 'filename' as input

   Facility: LOGIN, Login Processor

   Explanation: A file to be read by LOGINOUT (for example, a file
   containing the announcement message) cannot be opened. The message
   displayed to the system manager is OPENIN.

   User Action: Ensure that the file exists and that it has read
   access.

LOGIN-error opening primary input file SYS$INPUT

   Facility: LOGIN, Login Processor

   Explanation: The system cannot open the current input device and
   cannot perform the login. This message is usually accompanied by a
   VMS RMS message indicating the reason for the failure. The message
   displayed to the system manager is INPUTERR.

   User Action: Take corrective action based on the VMS RMS message,
   and repeat the login procedure, if possible.

LOGIN-error opening primary output file SYS$OUTPUT

   Facility: LOGIN, Login Processor

   Explanation: The system cannot open the current output device and
   cannot perform the login. This message is usually accompanied by a
   VMS RMS message indicating the reason for the failure. The message
   displayed to the system manager is OUTPUTERR.

   User Action: Take corrective action based on the accompanying
   message, and repeat the login procedure, if possible.

LOGIN-error protecting command interpreter pages

   Facility: LOGIN, Login Processor

   Explanation: An error occurred when you tried to write-protect the
   CLI code. The message displayed to the system manager is CLIPROT.

   User Action: Try the operation again later.

LOGIN-error protecting command interpreter tables pages

   Facility: LOGIN, Login Processor

   Explanation: An error occurred when the system tried to write-
   protect the command interpreter table pages. The message displayed
   to the system manager is CLITBLPROT.

   User Action: Try again. If the error reoccurs, report it to your
   system manager.

LOGIN-error reading command input

   Facility: LOGIN, Login Processor

   Explanation: An error occurred during the entry of the command;
   for example, the timeout period following the prompt for user name
   or password expired before you entered the responses. The message
   displayed to the system manager is CMDINPUT.

   User Action: Repeat the login procedure.

LOGIN-fatal job controller interaction problem

   Facility: LOGIN, Login Processor

   Explanation: An internal error occurred in the job controller
   during the login; the login cannot be performed. The message
   displayed to the system manager is JBCMIXUP.

   User Action: Repeat the login procedure. If the failure persists,
   notify the system operator or manager of the problem.

LOGIN-invalid password

   Facility: LOGIN, Login Processor

   Explanation: The specified password is incorrect. This message is
   not displayed to the user; it is written to the system accounting
   and security audit records. The message displayed to the user is
   "User authorization failure"; the message displayed to the system
   manager is INVPWD.

   User Action: None.

LOGIN-invalid SYS$INPUT for interactive login

   Facility: LOGIN, Login Processor

   Explanation: SYS$INPUT is a logical name for the input from a
   process to the system. When you use the system interactively,
   SYS$INPUT is assigned to your terminal by default. The system then
   acts upon the input it receives from your terminal. During your
   process, you can redefine SYS$INPUT to a data file; the system
   will then read input from the file. However, you cannot initiate
   an interactive process while SYS$INPUT is defined as a file.
   File-structured storage devices are not permitted as SYS$INPUT
   for interactive processes. The purpose of this restriction is to
   prevent LOGIN from reading a user name and password from a file.
   The message displayed to the system manager is INVINPUT.

   User Action: Use a non-file-structured device as SYS$INPUT for an
   interactive process.

LOGIN-licensed number of system users exceeded

   Facility: LOGIN, Login Processor

   Explanation: The maximum number of interactive users for which
   your system is licensed have already logged in. Further logins are
   currently disabled. The message displayed to the system manager is
   EXLICENSE.

   User Action: Log in after another user has logged off. If the
   maximum number of users is exceeded frequently, ask your system
   manager whether the system's license can be upgraded.

LOGIN-logins are currently disabled-try again later

   Facility: LOGIN, Login Processor

   Explanation: Logins are currently disabled. The message displayed
   to the system manager is LOGDISABLE.

   User Action: Do not attempt to log in at this time. Try again
   later.

LOGIN-maximum number of users exceeded-try again later

   Facility: LOGIN, Login Processor

   Explanation: The installation-defined maximum number of users
   has been reached. The message displayed to the system manager is
   EXQUOTA.

   User Action: Wait and try to log in later, after other users have
   logged out.

LOGIN-no such user

   Facility: LOGIN, Login Processor

   Explanation: The specified user name does not exist. This
   message is not displayed to the user; it is written to the system
   accounting and security audit records. The message displayed to
   the user is "User authorization failure"; the message displayed to
   the system manager is NOSUCHUSER.

   User Action: None.

LOGIN-qualifier not allowed in captive accounts

   Facility: LOGIN, Login Processor

   Explanation: You attempted to use qualifiers (for example, /CLI
   or /DISK) on an account logging in that is a captive account. If
   the account logging in is a captive account, no qualifiers may be
   changed. The message displayed to the system manager is CAPTIVE.

   User Action: Retry without specifying qualifiers.

LOGIN-system password timeout

   Facility: LOGIN, Login Processor

   Explanation: A user failed to correctly enter the system password
   within the allotted time period (as defined by the SYSGEN
   parameter LGI_PWD_TMO). This message is not displayed to the
   user; it is written to the system accounting and security audit
   records. The user does not receive a message display when this
   error occurs. The message displayed to the system manager is
   SYSPWDTMD.

   User Action: None.

LOGIN-unrecognized qualifier keyword

   Facility: LOGIN, Login Processor

   Explanation: An invalid qualifier is specified on the LOGIN
   command line. The message displayed to the system manager is
   CLIFAIL.

   User Action: Verify the command line you entered and repeat the
   login procedure.

LOGIN-user authorization failure

   Facility: LOGIN, Login Processor

   Explanation: You incorrectly entered your user name, your
   password, or both. The message displayed to the system manager
   is USERAUTH.

   User Action: Repeat the login procedure.

LOGIN-value required on qualifier

   Facility: LOGIN, Login Processor

   Explanation: You specified a qualifier without a value.

   User Action: Verify the command line you entered; specify a value
   and repeat the login procedure.

LOGIN-VMS host system modem not wired correctly-contact your system manager

   Facility: LOGIN, Login Processor

   Explanation: The modem connected to the VMS system is not
   asserting the proper signal control as described in the VMS I/O
   User's Reference Volume. (This message appears as NOTMODEM to the
   system manager.)

   User Action: Contact your system manager.

LOGIN-you are at maximum allowed processes for your account name

   Facility: LOGIN, Login Processor

   Explanation: No more processes may be logged in under this
   account. The message displayed to the system manager is ACNTEXC.

   User Action: Wait until another process logged in under this
   account has logged out.

LOGIN-you are at maximum processes for your user name

   Facility: LOGIN, Login Processor

   Explanation: No more processes may be logged in under this user
   name. The message displayed to the system manager is EXQUOTA.

   User Action: Wait until another process using this user name has
   logged out and retry.

LOGIN-you are not authorized to do reconnections

   Facility: LOGIN, Login Processor

   Explanation: You are not authorized to reconnect to disconnected
   processes. The message displayed to the system manager is
   DISRECONNECT.

   User Action: Log in again without specifying the /CONNECT
   qualifier after your user name.

LOGIN-you are not authorized to log in at this time

   Facility: LOGIN, Login Processor

   Explanation: At the present time, you are restricted from the
   class of login you are attempting. The login classes are: LOCAL,
   DIALUP, REMOTE, NETWORK, and BATCH. The system manager can
   restrict your use of each login class at specific times. The
   message displayed to the system manager is BADHOUR.

   User Action: If possible, try a different login class. For
   example, if you are currently restricted from BATCH logins, try an
   interactive class (LOCAL, REMOTE, or DIALUP). If you are currently
   restricted from all login classes, you cannot log in until you are
   permitted to use the system. You may also want to ask your system
   manager about the login restrictions for your account.

LOGIN-you are not authorized to log in from this source

   Facility: LOGIN, Login Processor

   Explanation: You do not have authorization for the login class
   you are attempting from the current source. The login classes
   are: LOCAL, DIALUP, REMOTE, NETWORK, and BATCH. The system manager
   can restrict your use of each login class at specific times. The
   message displayed to the system manager is RESTRICT.

   User Action: If possible, try a different login class. For
   example, if you are currently restricted from BATCH logins, try an
   interactive class (LOCAL, REMOTE, or DIALUP). If you are currently
   restricted from all login classes, you cannot log in until you are
   permitted to use the system. You may also want to ask your system
   manager about the login restrictions for your account.

LOGIN-you are not authorized to log in today

   Facility: LOGIN, Login Processor

   Explanation: You are restricted from the class of login you have
   attempted today. The system manager can restrict your use of a
   login class on specific days. The message displayed to the system
   manager is BADDAY.

   User Action: If possible, try a different login class. For
   example, if you are restricted from BATCH logins today, try
   an interactive class (LOCAL, REMOTE, or DIALUP). If you are
   restricted from all classes of logins today, you cannot log in
   until you are permitted to use the system. You may also want to
   ask your system manager about the login restrictions for your
   account.

LOGIN-you are not authorized to specify CLI parameters

   Facility: LOGIN, Login Processor

   Explanation: You do not have authorization to specify an alternate
   command language interpreter (CLI), or alternate CLI tables. The
   message displayed to the system manager is DEFCLI.

   User Action: Log in again without specifying the /CLI or /TABLES
   qualifiers after your user name.

LOGIN-your account has expired-contact your system manager

   Facility: LOGIN, Login Processor

   Explanation: When creating an account, the system manager can
   limit it to a specific time period, after which the account
   becomes invalid. Your account has exceeded its time limit. The
   message displayed to the system manager is ACNTEXPIR.

   User Action: Ask your system manager to renew your account.

LOGIN-your password has expired-contact your system manager

   Facility: LOGIN, Login Processor

   Explanation: Your password is valid for a specific length of time
   as determined by your system manager. When a password reaches the
   end of its specified time period, it expires and can no longer
   be used to gain access to the system. This is a system security
   feature that forces users to change their passwords on a regular
   basis. You should have been receiving advance messages notifying
   you when your password would expire. The message displayed to the
   system manager is PWDEXPIR.

   User Action: Ask your system manager for a new password.


LOGINIT

logfile initialized by operator 'filespec' logfile is 'filespec'

   Facility: OPCOM, Operator Communication

   Explanation: A DCL command REPLY/LOG successfully initialized
   a new operator communication log file. This message is
   informational.

   User Action: None.

LOGNAME

transaction log name is 'file-name'

   Facility: SYSTEM, VMS System Services

   Explanation: This informational message identifies the name of the
   transaction log file.

   User Action: None.

logical name is too long

   Facility: MOUNT, Mount Utility

   Explanation: A logical name contains more than 63 characters.

   User Action: Reenter the command; specify a logical name that has
   fewer than 63 characters.

LOGIO

NICONFIG requires LOG_IO privilege

   Facility: CNF, NI Configurator

   Explanation: NICONFIG must run with LOG_IO privilege.

   User Action: Install NICONFIG with LOG_IO privilege or run it from
   an account with LOG_IO privilege.

LOGLINK

network error creating link to node 'node-name::'

   Facility: MAIL, Mail Utility

   Explanation: An error occurred when MAIL attempted to use
   DECnet-VAX to communicate with another system. This message is
   usually accompanied by a system error message indicating the
   reason for the error.

   User Action: Resolve the problem and reenter the command.

LOG_IN_USE

unable to locate current end of file - dump aborted

   Facility: LMCP, Log Manager Control Program

   Explanation: The attempted log file dump has been aborted. LMCP
   was unable to locate the end of the log file as it is still in
   use.

   User Action: Try the dump when the system is less active.


LOGOPNM

open link to event monitor 'sink-name' at 'dd-mm-yy hh:mm:ss.ms'

   Facility: EVL, Event Logger

   Explanation: The event receiver opened a logical link to the
   specified event monitor program. This message displays the name
   of the program and the time stamp for the operation. This is an
   informational message.

   User Action: None.

LOGOPNR

connect accepted by event receiver from node 'node-id' at 'dd-mm-yy
hh:mm:ss.ms'

   Facility: EVL, Event Logger

   Explanation: The event receiver accepted a link from an event
   transmitter on the specified node. This message displays the
   identification of the node and the time stamp for the operation.
   This is an informational message.

   User Action: None.

LOGOPNT

open link to event receiver on node 'node-id' at 'dd-mm-yy
hh:mm:ss.ms'

   Facility: EVL, Event Logger

   Explanation: The event transmitter attempted to open a logical
   link to the event receiver on the specified node. This message
   displays the identification of the node and the time stamp for the
   operation. This is an informational message.

   User Action: None.

LOGTIME

logfile time stamp

   Facility: OPCOM, Operator Communication

   Explanation: This message, written periodically in the operator's
   log file, indicates that the system is functioning properly at the
   time specified.

   User Action: None.

LOGZERNEG

logarithm of zero or negative value

   Facility: MTH, Mathematics Facility

   Explanation: The LOG or DLOG math procedure is called with a zero
   or a negative number. The result returned is the reserved operand,
   minus zero.

   User Action: Locate the call to the library procedure that caused
   the error, and correct the argument that is zero or negative.

LONGDST

unable to include all module names in symbol table

   Facility: PATCH, Patch Utility

   Explanation: When you initialized its symbol, the image table
   could not accommodate all the module names it found.

   User Action: To determine which modules were placed in the symbol
   table, enter the PATCH command SHOW MODULE. To make room for the
   new modules, enter the PATCH command CANCEL MODULE specifying the
   module names whose symbols are no longer required. Then reenter
   the PATCH command SET MODULE.

LOOKUPERR

error looking up 'module-name' in 'library filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The Librarian could not find the requested module in
   the MNT, a VAX RMS error occurred, or there is not enough virtual
   memory available.

   User Action: Reenter the command line specifying an existing
   module name.

LOSTEXTHDR

file ('file-id') 'filename' lost extension file header

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that an extension file
   header is not in the extension file header chain of any file.
   The file header is rewritten with a deleted header, and the
   blocks allocated to the file header are marked free. The /CONFIRM
   qualifier is ignored in this action.

   User Action: None.

LOSTHEADER

file ('file-id') 'filename' not found in a directory

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified file is
   not cataloged in a directory. This error is neither reported nor
   repaired if any errors occurred in processing the directories on
   the volume set.

   User Action: If the /CONFIRM qualifier is specified, you may elect
   to catalog the file in directory [SYSLOST], or to delete the file.
   You may want to rerun the Verify Utility after repairs have been
   made.

LOSTSCAN

due to directory errors, lost files will not be entered

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered errors during the
   directory scan that were reported by previous messages. Therefore,
   lost files will not be entered in directory [SYSLOST].

   User Action: Refer to the suggested user actions for the
   previously reported errors, correct the errors, and reenter the
   Verify Utility command line.

Low Priority Command Queue Insert Failure

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the
   port; after 50 failed attempts, it marks the device off line. This
   error is caused by a failure to obtain access to an interlocked
   queue. Possible sources of the problem are CI hardware failures or
   memory, SBI (11/780), CMI (11/750), or BI (8200, 8300, and 8800)
   contention.

   User Action: Call you local DIGITAL field service representitive.

LOWQUOTA

one or more account quotas may be too low.

   Facility: VMSINSTAL, Install Procedures

   Explanation: When VMSINSTAL begins an installation, it makes sure
   that your process quotas are valid. This check failed.

   User Action: You are asked if you want to continue the
   installation. DIGITAL recommends that you correct this situation
   before continuing.

LRL_MISS

LRL must be specified

   Facility: SORT, Sort/Merge Utility

   Explanation: If a record I/O interface subroutine package is
   selected, the longest record length (LRL) must be passed to SORT
   in the call.

   User Action: Specify the LRL.

LSTERR

error generating listing file

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.

LSTMSG1

writing listing file

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is informational.

   User Action: None.

LSTMSG2

listing file SYSUAF.LIS complete

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This is an informational message.

   User Action: None.

LSTTOTBK

device 'device-name' contains a total of 'number' blocks; 'number'
defective blocks detected

   Facility: BAD, Bad Block Locator Utility

   Explanation: This informational message details the number of bad
   blocks.

   User Action: None.

LTC

line too complicated: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: There is excessive use of boldface, underlining,
   overstriking, and hyphenation on the line.

   User Action: Simplify the line.

LUNALRFRE

logical unit number already free

   Facility: LIB, Library Facility

   Explanation: A call is made to LIB$GET_LUN to free a logical unit
   number that is not allocated.

   User Action: Ensure that you use the correct logical unit number
   in the call to LIG$GET_LUN.

LUNRESSYS

logical unit number reserved to system

   Facility: LIB, Library Facility

   Explanation: A call is made to LIB$GET_LUN to reserve an invalid
   logical unit number. The range for logical unit numbers is 100 to
   119.

   User Action: Retry the operation specifying a valid logical unit
   number.

LVSADDER

error encountered testing longword vector-scalar addition

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

LVSMLTER

error encountered testing longword vector-scalar multiplication

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

LVSSBTER

error encountered testing longword vector-scalar subtraction

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

LVSSHLER

error encountered testing longword vector-scalar shift left

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

LVSSHRER

error encountered testing longword vector-scalar shift right

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - scalar arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

LVVMLTER

error encountered testing longword vector-vector multiplication

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

LVVSBTER

error encountered testing longword vector-vector subtraction

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   field service representative.

LVVSHLER

error encountered testing longword vector-vector shift left

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact your
   Digital customer service.

LVVSHRER

error encountered testing longword vector-vector shift right

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error during integer longword vector - vector arithmetic
   instruction set testing.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

MACHINECHK

machine check while in kernel mode

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable hardware
   error. Because of the severity of the error, further operation
   is impossible, or if it is possible, it might corrupt user data.
   After all of physical memory is written to a system dump file, the
   system will automatically reboot if the BUGREBOOT system parameter
   is set to one.

   User Action: Thoroughly test all system hardware components. If no
   hardware errors are located and if the problem persists, submit
   a Software Performance Report (SPR). The SPR should describe
   the conditions at the time of the error, and should include a
   BACKUP save set containing the system dump file and the error log
   file active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command to produce the save set.)

MACLBFMTER

macro library format error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A format error occurred in the MACRO library.

   User Action: Retry the assembly and, if the error still occurs,
   use the DCL command LIBRARY (see the VMS DCL Dictionary) to
   recreate the library from the source code.

MACNAMLNG

macro 'macro-name' name is too long in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. The name of the macro you attempted to insert into the
   library exceeds the name-length limit.

   User Action: Either rename the macro or extend the library's name-
   length limit.

MACRO or KEY required

   Facility: EDT, EDT Editor

   Explanation: The EDT command DEFINE is incomplete. You must
   specify either MACRO or KEY with the EDT command DEFINE using
   the format DEFINE MACRO or DEFINE KEY.

   User Action: Reenter the command including either MACRO or KEY.

MAILBOX

mailbox error

   Facility: CNF, NI Configurator

   Explanation: An error occurred while reading a mailbox.

   User Action: See the accompanying message to determine the
   appropriate action.

MAKEWSLE

make working set list entry error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

MANY_TO_ONE

input specifies multiple files, output a single file

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered a COPY command which
   has an input file specification which potentially represents more
   than one file, and an output specification which gives exactly one
   file.

   User Action: Reenter the command with a wildcard output file.
   EXCHANGE does not append multiple input files into a single output
   file, if that is what is desired it will be necessary to copy the
   files to a Files-11 volume and use the VMS COPY or APPEND commands
   to concatenate them. EXCHANGE can then be used to copy the result
   file to the output volume.

MAPAREA

file ('file-id') 'filename' invalid map area

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified file has
   a corrupted map area.

   User Action: The damage can probably be repaired by copying the
   file to a new version and deleting the original version. It might
   be necessary to reconstruct the file from backup media.

MAPCNTZER

attempted to generate zero length map pointer

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

MAPHDRBAD

storage map header is bad; volume locked

   Facility: MOUNT, Mount Utility

   Explanation: An I/O error is encountered during a mount operation
   or the header is corrupted. Existing files on the volume can be
   accessed but other operations, for example, create and delete, are
   not possible.

   User Action: Copy the files that are still accessible to a new
   volume. Reconstruct, as necessary, from backup media.

MATCH

match found against input string

   Facility: STR, String Manipulation Facility

   Explanation: A match is found for the input string that is passed
   to the routine. This message indicates a success.

   User Action: None.

MATCHED

file specification-'xxx' records, 'yyy' matches

   Facility: SEARCH, SEARCH Command

   Explanation: This message displays the name of the file, the
   number of records searched, and the number of records containing
   matches. This message is informational.

   User Action: None.

MATQUOMIS

matching quote is missing

   Facility: DEBUG, VMS Debugger

   Explanation: The matching quote at the end of a quoted string is
   missing.

   User Action: Correct the error and reenter the command.

Max input line of 2814749767 exceeded, file input terminated

   Facility: EDT, EDT Editor

   Explanation: You attempted to put more than 2,814,749,767 lines
   into a buffer. EDT stops accepting additional lines when it
   reaches this limit.

   User Action: None.

Max line number exceeded-lines no longer ascending; resequence recommended

   Facility: EDT, EDT Editor

   Explanation: EDT reached the limits of its line numbering
   capacity. If you continue to add lines to your buffer, EDT is
   no longer able to number them uniquely.

   User Action: You should resequence the buffer if you have fewer
   lines than line numbers.

Max number of lines for this buffer exceeded

   Facility: EDT, EDT Editor

   Explanation: You cannot add any more lines to this buffer.

   User Action: You can place any remaining lines in a different
   buffer.

MAXBAD

bad block table overflow

   Facility: INIT, INITIALIZE Command and BACKUP, Backup Utility

   Explanation: The specified volume has too many bad blocks; either
   the DCL command INITIALIZE cannot initialize the volume or the
   Backup Utility cannot process the volume. This message generally
   indicates that the disk volume can no longer be used.

   User Action: Check the status of the device and reenter the
   command. If the failure persists, reformat the disk. Notify the
   system manager. If the failure still persists and the disk pack is
   under warranty, it should be returned to DIGITAL.

MAXDEV

too many devices

   Facility: MOUNT, Mount Utility and DISMOUNT, DISMOUNT Command

   Explanation: More than 16 tape devices were specified in the DCL
   command MOUNT or the DCL command DISMOUNT.

   User Action: Reenter the DCL command MOUNT or the DCL command
   DISMOUNT; specify fewer than 16 devices.

MAXDIF

maximum number of difference records encountered-DIF aborted

   Facility: DIFF, DIFFERENCES Command

   Explanation: The number of differences that have been found exceed
   the number that you specified with the /MAXIMUM_DIFFERENCES
   qualifier. Therefore, the Differences Utility has terminated,
   listing only those difference records that it encountered before
   the maximum is reached.

   User Action: None.

MAXLAB

too many volume labels

   Facility: MOUNT, Mount Utility

   Explanation: More than 16 tape labels were specified in a DCL
   command MOUNT.

   User Action: Reenter the DCL command MOUNT; specify fewer than 16
   volume labels.

MAXLINKS

maximum links already defined

   Facility: LATCP, LAT Control Program

   Explanation: The maximum of two links on a CREATE LINK command
   already exists.

   User Action: None.

MAXMAPPEDBUF

a single buffer can be mapped to at most 'count' windows

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You attempted to map a window to a buffer that
   already has its maximum upper limit of windows mapped to it.

   User Action: Map the window to a different buffer.

MAXPARM

too many parameters-reenter command with fewer parameters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command contained more than the maximum number of
   parameters allowed. This error can be caused by:

   o  Leaving blanks on a command line where a special character, for
      example, a comma or plus sign, is required.

   o  Using symbol names or logical names which, when substituted or
      translated, contain embedded blank characters.

   o  Failing to place quotation marks around a character string with
      embedded blanks.

   User Action: Determine the reason for the error and correct the
   syntax of the command. Use the DCL command HELP or refer to the
   VMS DCL Dictionary to determine the correct number of parameters
   for the command.

MAXSERV

maximum number of services exceeded

   Facility: LATCP, LAT Control Program

   Explanation: Eight services have already been created on a service
   node.

   User Action: Delete one of the existing services before creating a
   new one.

MAXTOOBIG

maxunits specified is too large

   Facility: SYSGEN, System Generation Utility

   Explanation: The /MAXUNITS qualifier, as specified, caused an
   overrun in a word-sized length field when the length of the IDB is
   calculated.

   User Action: reenter the SYSGEN command CONNECT with a smaller
   /MAXUNITS number.

MAXUNITS

unit number greater than the maximum units specified

   Facility: SYSGEN, System Generation Utility

   Explanation: A unit number is encountered in creating the I/O
   database that is larger than the maximum number of units allowed
   (default = 8).

   User Action: Retry the operation using the /MAXUNITS qualifier on
   the SYSGEN command CONNECT.

MAXVALUE

maximum value is 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The argument value that you used exceeds the maximum
   value allowed.

   User Action: Use an argument that is within the valid boundaries.

MAXVOLS

too many volumes in volume set 'device-name'

   Facility: ANALDISK, Analyze/Disk_Structure Utility and BACKUP,
   Backup Utility

   Explanation: The volume set count recorded in the home block of
   relative volume 1 of an input volume set is greater than 255.
   Possibly, this value has been corrupted. Neither the Backup
   Utility nor the Verify Utility can process the volume.

   User Action: Reconstruct the volume set from backup media.

MAYNOTINDX

this mode may not be indexed

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The base mode is register, immediate, or literal
   mode.

   User Action: Change the addressing mode.

MBACBHUNG

MBA CBHUNG bit set

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

MBC

invalid multi-block count

   Facility: RMS, VMS Record Management Services

   Explanation: The multiblock count field of the RAB contains an
   invalid value. The multiblock count must be in the range of 0 to
   127.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

MBFULL

mailbox is full

   Facility: SYSTEM, VMS System Services

   Explanation: A write request to a mailbox failed because the
   mailbox is full and resource wait mode is not enabled. Its reader
   has not read the messages it contains.

   User Action: The writer of the mailbox can wait and try to write
   a message later, if possible. If the error occurs frequently,
   the amount of buffer space allocated when the mailbox is created
   should be increased so that more messages can be written before
   any are read.

MBTOOSML

mailbox is too small for request

   Facility: SYSTEM, VMS System Services

   Explanation: A write request to a mailbox failed because the
   message is larger than the maximum message size specified when
   the mailbox is created.

   User Action: Verify that the call to the service is coded
   correctly. Verify the maximum message size specified for the
   mailbox, and increase the size if necessary.

MBXASGERR

error assigning channel to vector information mailbox

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

MBXCRERR

error creating operator reply mailbox

   Facility: MOUNT, Mount Utility

   Explanation: The reply mailbox could not be created. This message
   is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

MBXCRTERR

error creating vector information mailbox

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

MBXRDERR

error reading operator reply mailbox

   Facility: MOUNT, Mount Utility

   Explanation: You are unable to read a mailbox. This message is
   issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

MBXREDERR

error reading from vector information mailbox

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

MBXWRTERR

error writing to vector information mailbox

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

MCHECK

detected hardware error

   Facility: SYSTEM, VMS System Services

   Explanation: A hardware machine check has occurred.

   User Action: Notify the system manager.

unexpected Machine Check

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: A machine check exception occurred during bootstrap
   execution.

   User Action: Run diagnostics on the satellite to check for
   hardware problems.


MCHINSTSYN

machine instruction syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A syntax error occurred in an instruction, for
   example, MOVL, A.

   User Action: Correct the instruction syntax.

MCNOTVALID

device microcode is not valid

   Facility: SYSTEM, VMS System Services

   Explanation: The microcode has not yet been successfully
   loaded or has become invalid. This is true only for the start
   microprocessor, initialize LPA11-K, set clock, and start data
   transfer request.

   User Action: Contact a DIGITAL field service representative.

MDBSFCRUPT

manufacturer's detected bad sector file is corrupt on 'device-name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: The header information in the redundant MDBSF is
   corrupted.

   User Action: Have the medium inspected.

MDBSFRFAI

failed to read the manufacturer detected bad sector file on 'device-
name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: This error can occur as the result of any the
   following reasons:

   o  The Bad Block Locator Utility could not locate a valid MDBSF.

   o  The Bad Block Locator Utility could not rebuild the MDBSF
      and SDBSF as a result of the execution context, for example,
      /EXERCISE=KEEP or /BAD_BLOCKS.

   o  The Bad Block Locator Utility could not locate a track copy
      of the SDBSF (before the last track copy) for display purposes
      as a result of the execution context /NOEXERCISE/BAD_BLOCKS
      /OUTPUT.

   User Action: Reinvoke the Bad Block Locator Utility with a
   suitable execution context to allow the utility to either display
   a converted device's bad block file without any attempt to modify
   its contents. Note that the device is converted through the MCR
   BAD/OVR command. Do not use the /BAD_BLOCKS qualifier or the
   /EXERCISE=KEEP qualifier or allow the Bad Block Locator Utility
   to recreate the bad blocks files with the default execution
   context of ANALYZE/MEDIA/EXERCISE 'device-name'. This implies
   the /EXERCISE=NOKEEP qualifier and no user-supplied bad block
   information. Therefore, do not specify the /BAD_BLOCKS qualifier.

MDFYERR

unable to update record

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Your record is not updated.

   User Action: Take corrective action based on the accompanying
   messages.

MDFYMSG

user records updated

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Your records were updated. This is an informational
   message.

   User Action: None.

MEDOFL

disk boot driver failure to open boot device

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: The satellite node could not put its remote system
   disk on line.

   User Action: Check the state of the system disk on the boot node.
   Use the SHOW DEVICE/SERVED command to ensure that the system disk
   is servable and on line.

medium is offline

   Facility: SYSTEM, VMS System Services

   Explanation: An I/O request cannot be satisfied because the
   device specified is not online and does not have a physical
   volume mounted on it. For example, on a STARTUP request the DEUNA
   hardware detected that the table from the DEUNA on the UNIBUS is
   not connected to the DEUNA bulkhead panel.

   User Action: Connect the cable from the DEUNA module on the UNIBUS
   to the DEUNA bulkhead panel. Mount the required volume on the
   device and repeat the request.


MEI

missing at least one .ENDIF command

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: End-of-file is detected and at least one conditional
   DSR command (.IF/.IFNOT) is not legally terminated.

   User Action: Insert the missing conditional commands. Check to see
   that DSR commands .IF/.ENDIF are matched within .REQUIRE files.

MEMBUG

dynmem error size = 'nn' addr = 'nn' error = 'nn'

   Facility: PATCH, Patch Utility

   Explanation: An internal PATCH error has occurred.

   User Action: Submit a Software Performance Report with a copy
   of the Image File and the Link Map. Indicate the information
   contained in the error message.

memory (de)allocation bug 'number', 'address', 'number'

   Facility: LINK, Linker Utility

   Explanation: There is a problem with the linker.

   User Action: Submit a Software Performance Report (SPR).


MEMERRS

errors occurred writing memory contents to the dump file

   Facility: SDA, System Dump Analyzer

   Explanation: The first block of the dump file contains information
   indicating that there were errors while writing out the contents
   of memory to the dump file.

   User Action: None. The dump file might not be useful for analysis.

MEMFUL

insufficient virtual address space to complete this link

   Facility: LINK, Linker Utility

   Explanation: Your virtual address space is not large enough to
   complete the link.

   User Action: Either increase the virtual address space available
   or decrease the size of the image. You can decrease the size of
   the image by (1) using shareable images or by (2) encouraging
   demand-zero compression if the image contains large data arrays.
   Contact your system manager to increase your VIRTUALPAGCNT or
   PAGFILQUOTA.

MEMNOTSVD

memory not saved in the dump file

   Facility: SDA, System Dump Analyzer

   Explanation: An attempt was made to examine the contents of a
   physical memory location that was not saved when the subsetted
   dump file was written. The requested information is not contained
   in the dump file.

   User Action: None.

Memory dump complete after 'nn' write error(s)

   Facility: BUGCHECK, System Bugcheck

   Explanation: This message indicates that the memory dump is
   finished; however, there are one or more write errors.

   User Action: When the system reboots, copy the dump to another
   file. You can determine the text associated with the hexadecimal
   status of pervious messages by using the F$MESSAGE lexical
   function or its equivalent. If the status indicates a possible
   disk problem, see the user action for the accompanying message.

Memory dump complete

   Facility: SYSTEM, VMS System Services

   Explanation: No errors were encountered during the dump write.
   This message indicates a normal status.

   User Action: None.

Memory dump complete after "dn" write errors

   Facility: SYSTEM, VMS System Services

   Explanation: Errors were encountered during the dump write
   operation.

   User Action: Be aware that analysis of the crash dump might not be
   possible.

Memory dump incomplete-dump file "dn" blocks too small

   Facility: SYSTEM, VMS System Services

   Explanation: Output after writing out the memory dump if there
   is no room in the dump file before writing out the full contents
   of physical memory and the dump file is at least two blocks too
   small.

   User Action: Make the memory dump file larger.

Memory dump incomplete-dump file 1 block too small

   Facility: SYSTEM, VMS System Services

   Explanation: Output after writing out the memory dump if there is
   no room in the dump file before writing out the full contents of
   physical memory and the dump file is one block too small.

   User Action: Make the memory dump file larger.

Memory dump incomplete - dump file 'nn' blocks too small

   Facility: BUGCHECK, System Bugcheck

   Explanation: This message indicates that the system was unable to
   write out the remaining 'nn' pages of a complete, physical memory
   dump (SYSGEN parameter DUMPSTYLE set to 0). The dump cannot be
   used because analysis depends on the System Page Table, which is
   kept in the uppermost physical pages of memory (that is, the last
   data to be written if this style of dump is written).

   User Action: If you have room on the volume that holds the system
   dump file, you can expand the dump file. If space is limited, you
   can try to write a selective dump. Refer to the Guide to Setting
   Up a VMS System for the correct procedures.

MERGE

'n' records to be merged

   Facility: ACCOUNTING, Accounting Utility

   Explanation: When the /LOG qualifier is used with the /SORT
   qualifier, this informational message describes the number of
   records to be sorted.

   User Action: None.

Message Free Queue Insert Failure

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the port;
   after 50 failed attempts it marks the device off line.

   This error is caused by a failure to obtain access to an
   interlocked queue. Possible sources of the problem are CI hardware
   failures or memory, SBI (11/780), CMI (11/750), or BI (8200, 8300,
   and 8800) contention.

   User Action: Contact your DIGITAL Field Service representative.

Message Free Queue Remove Failure

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the port;
   after 50 failed attempts it marks the device off line.

   This error is caused by a failure to obtain access to an
   interlocked queue. Possible sources of the problem are CI hardware
   failures or memory, SBI (11/780), CMI (11/750), or BI (8200, 8300,
   and 8800) contention.

   User Action: Call DIGITAL Field Service.

MFN

number illegal or malformed: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A plus sign (+)  or a minus sign (-) is used alone,
   instead of +n or -n.

   User Action: Insert the n value.

MFS

missing or improperly delimited file spec: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The file specification for the DSR command .REQUIRE
   is not enclosed in apostrophes or quotation marks.

   User Action: Enclose the file specification in apostrophes or
   quotation marks.

MFYNULPGFL

FREWSLE-no backing store, page not modified

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

MGTPRM

management program error

   Facility: NCP, Network Control Program

   Explanation: A software error occurred in the network management
   software.

   User Action: Submit a Software Performance Report (SPR).

MHDERR

module header error for 'module-name' in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The specified module has an invalid header.

   User Action: Compress the library before reentering the command
   line.

Micro-code Verification Error

   Facility: VAXport, VAXport Driver

   Explanation: The port driver attempts to reinitialize the port;
   after 50 failed attempts it marks the device off line.

   User Action: Call DIGITAL field service to check the port
   hardware.

MINVALUE

minimum value is 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You specified an argument value that is less than the
   minimum value allowed.

   User Action: Specify an argument that is within the valid
   boundaries.

MIRBFOVF

mirror buffer exceeded

   Facility: MOM, Maintenance Operation Module

   Explanation: An attempt to allocate a buffer to be used for a LOOP
   NODE or LOOP EXECUTOR command has failed. This might be because
   virtual memory has been exhausted.

   User Action: Increase the amount of virtual memory available for
   the process.

MIRCTF

mirror connect failed 'error'

   Facility: NCP, Network Control Program

   Explanation: This error occurs if the connection to a loopback
   mirror fails. A loopback mirror is a process created by the
   Network Control Program command LOOP NODE to transmit test
   messages. The 'error' indicates the reason for the connection
   failure. Some possible reasons for connection failure are an
   invalid or unrecognizable node name, a lack of network resources,
   or a busy or unreachable node.

   User Action: If the error occurred because of an incorrect node
   identifier, correct the identifier and reenter your command.
   If network resources are currently insufficient or if the node
   is inaccessible, reenter your command when the network and node
   become available.

MIRDIS

mirror link disconnected 'error'

   Facility: NCP, Network Control Program

   Explanation: This error occurs if the connection to a loopback
   mirror is made but subsequently disconnected. A loopback mirror is
   a process created by the Network Control Program command LOOP NODE
   to transmit test messages. The 'error' indicates the reason for
   the disconnection.

   User Action: If the error occurred because of an incorrect node
   identifier, correct the identifier and reenter your command.
   If network resources are currently insufficient or if the node
   is inaccessible, reenter your command when the network and node
   become available.

MISCONFUNI

unibus/qbus 'device-name' is misconfigured

   Facility: SYSGEN, System Generation Utility

   Explanation: The vector on the device specified in the message
   needs to be changed.

   User Action: Call Field Service.

MISENDSTA

missing END statement

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler expected an END statement to
   terminate the current terminal definition and this END statement
   is missing.

   User Action: Check your terminal definitions.

MISFILSPE

missing file specification in REQUIRE statement

   Facility: SMG, Screen Management Facility

   Explanation: The REQUIRE statement needs a file name in order
   to locate external definitions which should become part of your
   Termtable.

   User Action: Check your TERMTABLE.TXT. Add a file name to the
   REQUIRE statement.

MISINVNUM

misplaced invocation number in 'path-name'

   Facility: DEBUG, VMS Debugger

   Explanation: The invocation number was not placed after the
   innermost (rightmost) routine name in the specified path name.

   User Action: Correct the path name and reenter the command.

MISMODBEG

missing Module-Begin record in DST (compiler error)

   Facility: DEBUG, VMS Debugger

   Explanation: An expected Module-Begin record was not found in
   the Debug Symbol Table. This indicates a probable error in the
   compiler output.

   User Action: Submit a Software Performance Report (SPR).

MISMODEND

missing Module-End in DST for 'path-name' (compiler error)

   Facility: DEBUG, VMS Debugger

   Explanation: An expected Module-End record was not found in
   the Debug Symbol Table. This indicates a probable error in the
   compiler output.

   User Action: Submit a Software Performance Report (SPR).

MISNAMREQ

expected NAME or REQUIRE

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler expected TERMTABLE.TXT to
   begin with a terminal definition NAME statement or a REQUIRE
   statement. Something else is encountered.

   User Action: Check your TERMTABLE.TXT.

MISREQPAR

missing required parameter

   Facility: JBC, Job Controller

   Explanation: An item code that is required for the requested
   function is not present.

   User Action: Specify the required item.

MISSINGEND

missing .END statement

   Facility: MACRO, VAX MACRO Assembler

   Explanation: There is no .END directive at the end of the module.
   The assembler inserted an .END directive after the last line.

   User Action: Insert an .END directive.

MISSINGQUOTE

missing quote

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Your program has an opening quote character without a
   matching closing quote on the same line.

   User Action: Add the missing closing quote and recompile your
   program.

MISSNGPARM

missing parameter 'parameter-name'

   Facility: CDU, Command Definition Utility

   Explanation: The parameters specified for a designated verb in
   the command definition file are not consecutively named P1, P2,
   _ . . .

   User Action: Rename the parameters consecutively.

MISSNGSYM

missing argument

   Facility: CDU, Command Definition Utility

   Explanation: A required argument is missing from the CLD file.

   User Action: Add the missing argument to your CLD file.

MISS_PARAM

a required subroutine parameter is missing

   Facility: SORT, Sort/Merge Utility

   Explanation: You have omitted a required argument.

   User Action: Identify which argument is missing and specify it.

MISSPASS

missing PASSWORD command

   Facility: INPSMB, Input Symbiont

   Explanation: A batch job entered from a card reader does not
   contain a PASSWORD command following the JOB command.

   User Action: Correct the error and reenter the job.

MISSQUO

unmatched quotation marks in argument

   Facility: PATCH, Patch Utility

   Explanation: You did not use matching quotation marks or
   apostrophes to enclose an argument.

   User Action: Reenter the command using the correct quotation.

MISSQUOTE

quoted string not terminated before end of line

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an end-of-line while reading a quoted
   string from a CLD file.

   User Action: Edit the CLD file so that quoted strings do not cross
   line boundaries.

MISSYMTAB

missing symbol table

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A required symbol table is missing.

   User Action: Use the required symbol table or create one.

MISTERNAM

definition must begin with a terminal name

   Facility: SMG, Screen Management Facility

   Explanation: Capabilities were preceded by the name of a terminal.

   User Action: Check your terminal definitions. Make sure that each
   definition starts with NAME = 'terminal-name'.

MIXEDTYPES

operator with mixed or unsupported data types

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An operator is being used with operands of different
   or unsupported data types.

   User Action: Check the data type of each operand being used and
   make sure that the operator supports this.

MKD

ACP could not mark file for deletion

   Facility: RMS, VMS Record Management Services

   Explanation: The file system ACP cannot delete the file. This
   message is associated with a system status code returned from a
   file system ACP QIO requests made by VMS RMS.

   User Action: The status value (STV) field of the FAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.

MLBOPNERR

error opening macro library

   Facility: MACRO, VAX MACRO Assembler

   Explanation: An error occurred while attempting to open a macro
   library.

   User Action: Ensure that the file specification is a valid macro
   library.

MNL

missing number or letter: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A required numerical value or text value is missing.

   User Action: Insert the missing value.

MODIFIED

'file/directory/volume' modified

   Facility: SET, SET Facility

   Explanation: The requested file, directory, or volume is modified.
   This message is displayed when you specify the /LOG qualifier. The
   operation is successful.

   User Action: None.

MODIFYERR

modify error code of 'xx' on file 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: A VMS RMS $MODIFY request failed because of the error
   code, represented as 'xx'.

   User Action: Correct the error (represented as xx) and retry the
   request.

MODNAM

module 'module-name' name length is illegal-not 1 to 'decimal-
number'

   Facility: LINK, Linker Utility

   Explanation: A module contained a header record with an invalid
   module name.

   User Action: Submit a Software Performance Report on the
   appropriate language processor.

MODNAMLNG

illegal module-name 'module-name' of 'nnn' characters in 'library-
name '

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. The name of the object module you attempted to insert
   into the library exceeds the name-length limit.

   User Action: Rename the module before inserting it into the
   library.

MODNOTADD

insufficient symbol table space to add module 'module-name'

   Facility: PATCH, Patch Utility

   Explanation: The PATCH command SET MODULE failed. This typically
   occurs when there is not enough space in the symbol table to
   accommodate the additional module or modules.

   User Action: To make room for the new modules, enter the following
   PATCH commands:

   o  SHOW MODULE command to determine which modules are in the
      symbol

   o  CANCEL MODULE command specifying the module names whose symbols
      are no longer required

   o  SET MODULE command

MODNOTFND

library module 'module-name' not found in record 'number'

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont library
   input routine indicating the specified library module is not found
   while processing this record. The print symbiont failed to locate
   the specified module in the device control library associated with
   this queue.

   User Action: Insert the library module or specify the correct
   module library.

MODOUTAI

RMS after-image journaling disabled on saved copy of 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: After-image journaling has been disabled on the saved
   copy of the file. This message is informational.

   User Action: None.

MODOUTAIS

RMS after-image journaling disabled on saved copy of 'filespec'
('file-id')

   Facility: BACKUP, Backup Utility

   Explanation: After-image journaling has been disabled on the saved
   copy of the file in the standalone BACKUP operation. That is, if
   the disk is restored, the journal command must be reentered. This
   message is informational.

   User Action: None.

MODOUTBI

RMS before-image journaling disabled on saved copy of 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: Before-image journaling has been disabled in the
   BACKUP operation. That is, if the disk is restored, the journal
   command must be reentered. This message is informational.

   User Action: None.

MODOUTBIS

RMS before-image journaling disabled on saved copy of 'filespec'
('file-id')

   Facility: BACKUP, Backup Utility

   Explanation: Before-image journaling has been disabled on the
   saved copy of the file in the standalone BACKUP operation.
   That is, if the disk is restored, the journal commands must be
   reentered. This message is informational.

   User Action: None.

MODQUOTA

error modifying quota record for ['UIC']

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to modify the usage data in the quota file entry for
   the specified UIC. The accompanying message provides additional
   information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.

MODRANGEMARKS

MODIFY_RANGE requires either two marks or none

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You must specify both new ends of the range to be
   modified or that there aren no new ends.

   User Action: Correct the call to MODIFY_RANGE, using the
   BEGINNING_OF or END_OF built-in procedure.

MODRELNBAK

no backing store address for modified page

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

MOUNEWVOL

MOUNT new relative volume nn (volume label) on 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: During a write operation, the end-of-tape has been
   reached on the last reel of a volume set.

   User Action: Mount a new relative volume to be added to the tape
   set.

MOUNTDEV

please mount 'name' device 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: A request for operator assistance on MOUNT has
   occurred.

   User Action: You can wait for operator assistance, perform the
   request yourself, or abort the request.

MOUNTED

'volume-label' mounted on 'device- name'

   Facility: MOUNT, Mount Utility

   Explanation: This is an informational message that verifies a
   request.

   User Action: None.

MOUNTERR

volume 'volume' on 'device' was not mounted because 'reason'

   Facility: BACKUP, Backup Utility

   Explanation: BACKUP was unable to mount the specified volume for
   one of the following reasons:

   o  The expiration date specified in the volume label is in the
      future. That is, the data on the volume has not expired.

   o  Its label does not match the one requested. The label specified
      in the BACKUP command (either explicitly or implicitly) does
      not match the label on the volume.

   o  It is protected against access. The protection specified in
      the volume header disallows access by the person entering the
      BACKUP command.

   User Action: At this point BACKUP allows you to either quit
   the operation, overwrite the volume label and continue, or put
   a new volume in the drive and continue processing. To abort
   the operation, enter the QUIT command at the BACKUP> prompt.
   To overwrite information in the volume header and continue
   processing, enter the OVERWRITE command at the BACKUP> prompt. To
   restart the operation with a new volume, enter the NEW command at
   the BACKUP> prompt. If the QUIT or NEW command is chosen, BACKUP
   will automatically dismount the volume.

MOUNTERROR

error occurred during VMS mount on 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encounted an error while using
   the $MOUNT system service to mount a volume.

   User Action: A second message will follow, giving the specific
   condition discovered by the $MOUNT service. Take corrective action
   based on the second message.

MOUNTF11

'filespec' must be mounted Files-11

   Facility: BACKUP, Backup Utility

   Explanation: The specified volume is mounted with the /FOREIGN
   qualifier. However, for the given operation, the volume must be
   mounted without the /FOREIGN qualifier.

   User Action: Reevaluate the operation, checking that the correct
   I/O devices have been specified and that the /SAVE_SET, /PHYSICAL,
   and /IMAGE qualifiers are properly used. Then, if appropriate,
   mount the specified volume without the /FOREIGN qualifier, and
   reenter the command.

MOUNTFOR

'device' must be mounted /FOREIGN

   Facility: BACKUP, Backup Utility

   Explanation: The specified volume is mounted without the /FOREIGN
   qualifier. However, for the given operation, the volume must be
   mounted with the /FOREIGN qualifier.

   User Action: Reevaluate the operation, checking that the correct
   I/O devices have been specified and that the /SAVE_SET, /PHYSICAL,
   and /IMAGE qualifiers are properly used. Then, if appropriate,
   mount the specified volume with the /FOREIGN qualifier, and
   reenter the command.

MOUNTVER 'device-name' contains the wrong volume. Mount verification in progress.

   Facility: SYSTEM, VMS System Services

   Explanation: The media in the named disk or tape drive has been
   changed and is no longer that expected by the system. Mount
   verification recovery procedures started.

   User Action: Return the correct media to the named disk or tape
   drive.

MOUNTVER 'device-name' has aborted mount verification

   Facility: SYSTEM, VMS System Services

   Explanation: Mount verification was unable to restore access
   to the named disk or tape. Either access could not be restored
   in the timeout interval specified by system parameters, or an
   error occurred during the attempts to restore access from which no
   recovery was possible.

   User Action: The named disk or tape is inaccessable to system
   users. Access can be restored only by dismounting and remounting
   device.

MOUNTVER 'device-name' has been write-locked. Mount verification in progress

   Facility: SYSTEM, VMS System Services

   Explanation: The write-locking hardware on the named disk or tape
   drive was activated at a time when there is write activity for the
   device. Mount verification recovery procedures have started.

   User Action: Deactivate the write-locking hardware on the named
   disk or tape.

MOUNTVER 'device-name' has completed mount verification

   Facility: SYSTEM, VMS System Services

   Explanation: The previously named problem, which initiated mount
   verification is corrected. Normal access is restored to the named
   disk or tape.

   User Action: None.

MOUNTVER 'device-name' is offline. Mount verification in progress

   Facility: SYSTEM, VMS System Services

   Explanation: The named disk or tape is off line. Mount
   verification recovery procedures have been initiated.

   User Action: If manual intervention is required to make the named
   disk or tape operative, perform the necessary action. For example,
   if a disk has become off line because its unit plug was removed,
   replace the unit plug.

MOUNVTER 'member-unit' has been removed from shadow set

   Facility: SYSTEM, VMS System Services

   Explanation: The named shadow set member unit has been removed
   from its shadow set. The name of the shadow set virtual unit
   appears in an accompanying "shadow set has been reduced" message.

   User Action: Correct the problem that caused the member's removal
   and return the member to the shadow set using a MOUNT command.

MOUNVTER 'member-unit' is a possible shadow set member

   Facility: SYSTEM, VMS System Services

   Explanation: The named member drive was recently operational in
   a shadow set that has been reduced to zero working members. The
   name of the affected shadow set virtual unit appears in a previous
   "zero working members" message.

   User Action: Take action to make the member drive operational.

MOUNVTER 'member-unit' is an incorrect shadow set member volume.

   Facility: SYSTEM, VMS System Services

   Explanation: The media in the named member drive has been changed
   and is no longer that expected. In most cases, this message is
   followed by a message indicating that the named member has been
   removed from the shadow set. However, if the shadow set has been
   reduced to zero members, mount verification does not remove the
   member drive but waits for the correct media to be returned to the
   member drive.

   User Action: If the member is not removed from the shadow set,
   return the correct media to the named member drive.

MOUNVTER 'member-unit' shadow copy has been completed

   Facility: SYSTEM, VMS System Services

   Explanation: A previously initiated shadowing copy operation,
   targeted at the named member drive, finished.

   User Action: None.

MOUNVTER 'member-unit' shadow copy has been started

   Facility: SYSTEM, VMS System Services

   Explanation: A shadowing copy operation started with the named
   member drive as its target.

   User Action: None.

MOUNVTER 'shadow-unit' all shadow set copy operations are completed

   Facility: SYSTEM, VMS System Services

   Explanation: All required shadowing copy operations have been
   completed for the named shadow set virtual unit. The shadow set is
   not internally consistent and is fully subject to normal shadowing
   data propogation and availability rules.

   User Action: None.

MOUNVTER 'shadow-unit' contains zero working members

   Facility: SYSTEM, VMS System Services

   Explanation: The named shadow set virtual unit has no working
   member drives. Accompanying "possible shadow set member" messages
   name previously working member drives that mount verification
   expects to be returned to operational status.

   User Action: Take action to make one of the subsequently named
   member drives operational.

MOUNVTER 'shadow-unit' does not contain the member named to VMB. System may not reboot.

   Facility: SYSTEM, VMS System Services

   Explanation: The named shadow set virtual unit is the virtual unit
   from which the system has been booted. For this partictuar shadow
   set virtual unit, the single shadow set member named in the input
   to the primary bootstrap program (VMB) is no longer a shadow set
   member. Because of shadow set booting mechanics, this condition
   may render the system unbootable.

   User Action: The single shadow set member named in the input to
   the primary bootstrap program (VMB) MUST be returned as a member
   of the system disk shadow set ASAP.

MOUNVTER 'shadow-unit' shadow set has been reduced

   Facility: SYSTEM, VMS System Services

   Explanation: The named shadow set virtual unit has had one or
   more members removed, as described in previous "member has been
   removed" messages.

   User Action: Correct the problem that caused the member's removal
   and return the member to the shadow set using a MOUNT command.

MOUNVTER 'shadow-unit' shadow set has changed state. Mount verification in progress.

   Facility: SYSTEM, VMS System Services

   Explanation: The named shadow set virtual unit has signaled a
   possible change of membership or accessibility status. Mount
   verification recovery procedures have been initiated.

   User Action: No action is necessary unless indicated by additional
   mount verification messages.

MOUSEINV

mouse location information is invalid

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The mouse information is only valid after a mouse
   key has been received. You are attempting to use a mouse function
   before a mouse key is pressed.

   User Action: Mouse functions should only be called by procedures
   bound to the mouse keys.

MOUVOL

MOUNT relative volume 'nn' on 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: During a read operation, the operator is requested to
   mount the next reel in a multivolume set.

   User Action: Mount the indicated reel on the device specified.

MOVEFILES

files will now be moved to their target directories.

   Facility: VMSINSTAL, Install Procedures

   Explanation: If sufficient disk space is available at the
   beginning of an installation, VMSINSTAL builds new files in a
   working directory for the optional product or update. After all
   the files are built, they are moved to their target directories.
   This message is informational.

   User Action: None.

MOVETOCOPY

move from unmodifiable buffer 'string' changed to copy

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You cannot change the source buffer, so the MOVE_TEXT
   request has been changed to a COPY_TEXT.

   User Action: Use the SET (MODIFIABLE, . . . ) built-in to allow
   modifications.

MQS

missing or improperly delimited quoted strings: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A beginning or ending apostrophe or quotation mark is
   missing from the quoted text value.

   User Action: Insert the missing apostrophe or quotation mark.

MRC

another n crossed margin or bad right indent attempts detected and
accumulated. Now being reported

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A specific number (n) of similar horizontal spacing
   errors have been detected and are now being reported. These errors
   are triggered by DSR commands .CHAPTER or .APPENDIX or by the end-
   of-file. The count of errors is cleared after each DSR command
   .CHAPTER and .APPENDIX or after the end-of-file.

   User Action: Check the margin and indent settings.

MRG

margins crossed, or attempted indent too far right

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The right margin has crossed the left margin or the
   left margin has crossed the right margin, or an invalid indent has
   been specified.

   User Action: Check the margin and indent settings.

MRGGTMTCH

value of 'x' for /MERGE is greater than /MATCH value of 'y' /MERGE
set to 'y'

   Facility: DIFF, DIFFERENCES Command

   Explanation: You specified a /MERGE value greater than the /MATCH
   value.

   User Action: Decrease the /MERGE value. The /MERGE value must
   always be less than or equal to the /MATCH value.

MRN

invalid maximum record number or record number exceeds MRN

   Facility: RMS, VMS Record Management Services

   Explanation: An incorrect record number is specified in one of the
   following ways:

   1. The maximum record number field contains a negative value for
      the creation of a relative file.

   2. The relative record number (pointed to by KBF) for a random
      operation to a relative file exceeds the maximum record number
      specified when the file is created.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. Modify the program, if necessary, to detect and respond
   to the condition.

MRS

invalid maximum record size

   Facility: RMS, VMS Record Management Services

   Explanation: The maximum record size (MRS) field contains zero for
   a $CREATE operation with fixed length records or a relative file.
   Or the maximum record size specified for a magnetic tape file is
   less than 18.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

missing one or more .RESTORE commands at end of file

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You have specified fewer .RESTORE commands than .SAVE
   commands.

   User Action: Specify the correct number of .RESTORE commands.


MSCPNOTLD

MSCP-Server code not loaded

   Facility: SET, SET Facility and SHOW, SHOW Command

   Explanation: The code for the MSCP Server is not loaded at system
   generation.

   User Action: Make sure the MSCP Server code is loaded before
   trying to enter the SET DEVICE command or the SHOW DEVICE command.

MSCPSERV

encountered unrecoverable error

   Facility: MSCP, MSCP Server

   Explanation: The MSCP server encountered an unrecoverable error.

   User Action: Submit a Software Performance Report (SPR). Include a
   copy of the crash dump with the Report (SPR).

MSGBUFSET

attempt to change modifiable setting of message buffer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The message buffer cannot be set to be either
   modifiable or unmodifiable.

   User Action: Do not attempt to change the modifiable setting of
   the message buffer.

MSGCMAIIF

missing comma in .IIF statement

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The condition is not separated from the statement in
   an .IIF directive.

   User Action: Insert a comma in the directive.

MSGNOTFND

message not in system message file

   Facility: SYSTEM, VMS System Services

   Explanation: A message identification number specified in a
   system service call or a lexical function does not have a message
   associated with it.

   User Action: Check for a programming error.

message was not found, the default message has been returned

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The message identification code that you specified
   was not found. The default message is returned.

   User Action: None.


MSGQUEEMPTY

free message queue empty; requestor PID: 'pid'

   Facility: AUDSRV, Audit Server

   Explanation: The audit server encountered an unexpected internal
   error.

   User Action: Please submit a Software Performance Report (SPR)
   and include the process dump file SYS$SYSROOT:[SYSEXE]AUDIT_
   SERVER.DMP, if one exists.

MSTINTERR

error initializing master process

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

MTLBLLONG

label specified for 'device-name' is longer than 6 characters

   Facility: INIT, INITIALIZE Command

   Explanation: The label the operator specified for the device is
   longer than six characters.

   User Action: Respecify the label with six or fewer characters.

magnetic tape volume label can be no more than six characters

   Facility: SYSTEM, VMS System Services

   Explanation: The label specified for a magnetic tape volume has
   more than six characters.


MTLBLNONA

label specified for 'device-name' contains non-ANSI "a" characters

   Facility: INIT, INITIALIZE Command

   Explanation: The operator used invalid ANSI "a" characters in
   the volume label. The set of valid ANSI "a" characters includes:
   digits 0..9, uppercase A..Z, space, and ! " % & ' () * + ,-. / :
   ; < => ?

   User Action: Reenter the command with valid ANSI "a" characters.

MTXCNTNONZ

mutex count nonzero at system service exit

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written
   to a system dump file, the system automatically reboots if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

MULCLUOPT

cluster 'cluster-name' multiply defined in options file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A cluster is defined more than once in an options
   file.

   User Action: Delete one of the definitions and relink.

MULDEF

symbol 'symbol-name' multiply defined in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: A global symbol is defined with different values.

   User Action: Delete one of the definitions and relink.

MULDEFLBL

multiple definition of label

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The same label is defined twice in the module.

   User Action: Delete the second label definition or change one of
   the labels to a different symbol name.

MULDEFPSC

psect 'psect-name' multiply defined in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: A psect is defined more than once in a single object
   module.

   User Action: Correct the source, recompile, and relink.

MULPRI

multiple primary definition in statement 'number'

   Facility: FDL, Create/FDL Utility and FDL, Edit/FDL Utility

   Explanation: The same primary attribute was specified in more
   than one place in the FDL file. The line number given is where the
   second definition appears.

   User Action: Delete one of the definitions.

MULPSC

conflicting attributes for psect 'psect-name' in module 'module-
name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The attributes for a psect were found to be different
   in subsequent modules of the link.

   User Action: Correct the source so that all instances of the same
   psect have the same attributes.

MULSEC

multiple secondary definition in statement 'number'

   Facility: FDL, Create/FDL Utility and FDL, Edit/FDL Utility

   Explanation: The same secondary attribute was specified in more
   than one place in a primary. The line number is where the second
   definition appears.

   User Action: Delete one of the definitions.

MULSHRPCS

psect 'string' defined in shareable image 'image name' is multiply
defined in shareable image 'image name'

   Facility: LINK, Linker Utility

   Explanation: A program section defining COMMON area (such as those
   used in VAX BASIC, VAX PL/I, VAX FORTRAN, and VAX C) is defined in
   two shareable images. The linker is not able to properly resolve
   references to it.

   User Action: For further information on Sharable Images, refer
   to the the Linker Utility in the VMS Linker Utility Manualwhich
   explains how to link COMMON areas.

MULTALLOC

file ('file-id') 'filename' multiply allocated blocks VBN 'n' to 'n'
LBN 'n' to 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified logical
   blocks on the specified relative volume were allocated to more
   than one file. These blocks are the specified virtual blocks of
   the specified file.

   User Action: Examine all the multiply allocated blocks messages
   to determine the files involved in each instance of multiple
   allocation. Then, without allowing other file activity, perform
   the following functions:

   o  Copy all but one file involved in each instance to a new
      version.

   o  Delete the version of each file that is copied that contains
      the multiple allocation. This action marks blocks free in the
      storage bit map that are not, in fact, free blocks.

   o  Reenter the Verify Utility command line with the /REPAIR
      qualifier to correct the storage bit map.

   o  Examine each file for corruption and reconstruct from backup
      media as necessary.

MULTCHNG

attribute cannot be specified twice

   Facility: CDU, Command Definition Utility

   Explanation: You specified multiple syntax for a single qualifier.

   User Action: Include one syntax reference for each qualifier.

MULTECO

multiple eco levels ('nn' and 'nn') set for one patch

   Facility: PATCH, Patch Utility

   Explanation: You attempted to define a second ECO level before
   setting the first ECO level.

   User Action: To set the first ECO level, enter the PATCH Utility
   command UPDATE.

MULTEXTHDR

file ('file-id') 'filename' multiply allocated extension file header

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the specified extension
   file header is in the extension header chain of more than one
   file.

   User Action: The damage can be repaired by copying the volume to
   fresh media or by copying all the files to new versions and then
   deleting the original versions. Examine each file for corruption
   and reconstruct from backup media as necessary.

MULTFR

multiply defined transfer address in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: More than one object module contains a strong
   transfer address.

   User Action: Delete all but one of the transfer addresses.

MULTIDEF

parameter/local/constant 'name' multiply defined

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The parameter, local, or constant is defined more
   than once.

   User Action: Rename the parameter, local, or constant so that it
   has a unique name.

MULTIPLENAMES

there is more than one name matching, all are returned

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedure EXPAND_NAME has found more
   than one name matching the given string and has returned a string
   of concatenated names that match.

   User Action: None.

MULTISELECT

multiple identical CASE selectors

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Multiple identical selectors were specified in a
   single CASE statement or error condition handler.

   User Action: Specify a selector only once.

MULTOPR

multiple successive operators in expression

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: You entered an expression containing adjacent
   operators.

   User Action: Use angle brackets or parentheses, depending on
   the current language, to separate the operators or enter a valid
   expression.

MULTRMS

multiple RMS vectors specified

   Facility: SYSTEM, VMS System Services

   Explanation: This severe error message is associated with a status
   code returned from a system service request. Multiple VMS RMS
   vectors have been specified for privileged shareable images.

   User Action: Only one VMS RMS vector can be specified for an
   executable image. Remove the vector associated with the problem
   and relink.

MUSTBECONST

expression must be a compile-time constant

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The compiler requires a compile-time-constant-
   expression, and the expression used does not meet these criteria.

   User Action: Evaluate and correct the expression.

MUSTBEONE

string must be 1 character long

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A keyname must be one character only.

   User Action: Enter the string again using a one-character keyname.

MUSTCLOSEFL

must close file

   Facility: SYSTEM, VMS System Services

   Explanation: No more operations can be performed on a file, for
   example, because the position on a magnetic tape is lost. The file
   must be closed before processing can continue.

   User Action: Retry the operation; take corrective action based on
   previously reported errors.

MVABORTED

'date-time', Mount verification aborted for device 'device-name'

   Facility: OPCOM, Operator Communication

   Explanation: The mount verification was aborted for some reason,
   possibly because the volume was compromised.

   User Action: Dismount and remount the volume.

MVCOMPLETE

'date-time', Mount verification completed for device 'device-name'

   Facility: OPCOM, Operator Communication

   Explanation: Mount verification has successfully completed.

   User Action: None.

NAFADDERR

unable to add record to NETPROXY.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The record you specified could not be added to the
   network user authorization file (NETPROXY.DAT). This message
   should be accompanied by a VMS RMS message that identifies the
   specific reason for the error. For example, this error occurs if
   you try to add a record authorizing a remote user to access more
   than one local account. Each user at a remote node is allowed to
   access the files of only one user on the local node.

   User Action: If possible, correct the condition identified
   by the VMS RMS message and reenter your command. Otherwise,
   examine the network user authorization file to determine
   why the record could not be added. You can display the
   contents of the file by using the AUTHORIZE command
   SHOW/PROXY. You can write the contents of NETPROXY.DAT to a
   listing file by using the AUTHORIZE command LIST/PROXY. If you
   want to delete a current record from NETPROXY.DAT in order to add
   a new record, use the AUTHORIZE command REMOVE/PROXY.

NAFAEX

NETPROXY.DAT already exists

   Facility: AUTHORIZE, Authorize Utility

   Explanation: A network user authorization file (NETPROXY.DAT)
   already exists for the local node.

   User Action: If you want to create a new network user
   authorization file, either delete or rename the current one (if
   you have sufficient privilege to do so). Once the current file
   has been deleted or renamed, reenter the AUTHORIZE command CREATE
   /PROXY. Note that you must have sufficient privilege to create a
   new file.

NAFCONERR

connect error on NETPROXY.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Connect error on to network user authorization file
   (NETPROXY.DAT).

   User Action: Take corrective action based on the accompanying
   messages.

NAFCREERR

unable to create NETPROXY.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: A network user authorization file (NETPROXY.DAT)
   could not be created. This message should be accompanied by a VMS
   RMS message that identifies the specific reason why the file could
   not be created. For example, this error occurs if you do not have
   sufficient privilege to create the file.

   User Action: Correct the condition identified by the RMS message
   and reenter your command.

NAFDNE

NETPROXY.DAT does not exist

   Facility: AUTHORIZE, Authorize Utility

   Explanation: A network user authorization file (NETPROXY.DAT) does
   not exist on the local node.

   User Action: If you have sufficient privilege, use the AUTHORIZE
   command CREATE/PROXY to create a network user authorization
   file. Then you can add records to the file by using the AUTHORIZE
   command ADD/PROXY.

NAFDONEMSG

network authorization file modified

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The network user authorization file (NETPROXY.DAT)
   has been modified to reflect the change directed by your command.

   User Action: None.

NAFNOMODS

no modifications made to network authorization file

   Facility: AUTHORIZE, Authorize Utility

   Explanation: No modifications have been made to the network user
   authorization file (NETPROXY.DAT).

   User Action: None.

NAFUAEERR

entry already exists in NETPROXY.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The record you have tried to add to the network
   user authorization file is already in the file; it has not been
   duplicated.

   User Action: None.

NAM

invalid NAM block or NAM block not accessible

   Facility: RMS, VMS Record Management Services

   Explanation: The VMS RMS NAM block is not in the correct format,
   or it is not in an area of memory that can be written by the
   caller.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly and that the NAM block was not modified during execution
   of the program.

NAMETOOBIG

user name too long

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The user name you specified is longer than 12
   characters.

   User Action: Enter a user name no longer than 12 characters.

NAOFIL

unable to open SYSUAF.DAF

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The system user authorization file cannot be opened.
   This error can occur if the file is not located in the current
   default directory, or if you do not have sufficient privilege to
   access the file. This message should be accompanied by a VMS RMS
   message specifying the reason why the file cannot be opened.

   User Action: If the file could not be found, set your default
   directory to SYS$SYSTEM and then reenter your command. If you do
   not have sufficient privilege to access the file, there is nothing
   you can do unless your system manager can grant you the necessary
   privilege.

NAONAF

unable to open NETPROXY.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The network user authorization file (NETPROXY.DAT)
   could not be opened. This message should be accompanied by a VMS
   RMS message that identifies the specific reason for the error.
   Possible reasons are insufficient privilege, file protection
   violation, or location of the file in the wrong directory.

   User Action: If you do not have sufficient privilege to open
   NETPROXY.DAT, there is nothing you can do except to ask a
   privileged user, such as your system manager, to access the file
   for you. If you do have sufficient privilege, make sure the file
   is located in the proper directory and is not protected against
   read or write access. Then reenter your command.

NARG

wrong number of arguments

   Facility: CONVERT, Convert Utility

   Explanation: You specified an incorrect number of arguments in a
   call to CONV$PASS_FILES, CONV$PASS_OPTIONS, or CONV$CONVERT.

   User Action: Refer to the VMS System Services Reference Manual for
   details about calling these routines.

NCBFAIL

undefined object on local node

   Facility: MOM, Maintenance Operation Module

   Explanation: An error has been detected in a Network Control
   Block. This is a program logic error and should be reported.

   User Action: Submit a Software Performance Report (SPR).

NCS

no corresponding SAVE for attempted RESTORE

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You have specified more .RESTORE commands than .SAVE
   commands.

   User Action: Specify the correct number of .RESTORE commands.

NEEDBOTH

no authorization file-need both a password and a group number

   Facility: CAF, Cluster Authorization File Service

   Explanation: You specified an invalid group number with the
   CONFIGURATION SET CLUSTER_AUTHORIZATION command.

   User Action: Reenter the command with a numeric group number
   between 1 and 65535.

NEEDFILENAME

type file name or just RETURN to delete buffer 'buffer-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You modified a writable buffer, but there is no file
   name associated with the buffer.

   User Action: Enter a file name if you want the contents of the
   buffer written to a file. Otherwise, press the RETURN key.

NEEDMORE

unexpected end of command line

   Facility: DEBUG, VMS Debugger

   Explanation: The command entered is not complete. A required part
   of the command is omitted.

   User Action: Reenter the complete command.

NEEDTERMS

you must specify some word terminators for FILL

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedure FILL requires you to supply
   characters that determine where to break the lines being filled.

   User Action: Specify a string that contains at least one word
   terminator that you want the built-in procedure FILL to use.

NEEDTOASSIGN

built-in call must return a value

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This built-in procedure may only be used in
   situations where its return value is used. The built-in procedure
   must be on the right-hand side of an assignment statement.

   User Action: You must use this built-in procedure as part of an
   assignment statement or as part of an expression.

NEF

not positioned to EOF on $PUT (sequential organization only)

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $PUT request is attempted for a sequential
   file that is not currently positioned at the end of the file.

   User Action: Verify that the call to the VMS RMS service is
   programmed correctly. Modify your program, if necessary, to detect
   and respond to the condition.

NEGATED

entity explicitly negated in command string

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified qualifier or keyword is present in its
   negated form (with NO).

   User Action: None.

NEGSHBREF

shared memory control block negative refcnt

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NEGSTRLEN

negative string length

   Facility: STR, String Manipulation Facility

   Explanation: Successful completion except that a length parameter
   to a string routine had a negative value. Lengths of strings must
   always be positive or zero; zero is used.

   User Action: Verify that all parameters containing string lengths
   do not contain negative numbers.

NEGTIM

a negative time is computed

   Facility: LIB, Library Facility

   Explanation: The computed time is less than the system zero date
   (17-NOV-1858).

   User Action: Examine each argument and the order which they are
   passed. Debug and correct the problem.

NESTERROR

nesting level exceeded

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A nested CASE, LOOP, or IF statement exceeds the
   maximum nesting level of 20.

   User Action: Do not nest CASE, LOOP, or IF statements more than 20
   levels deep.

NESTLEVEL

nesting level exceeded in macro 'macro-name' file 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. The specified macro exceeded the nesting limit of 63.

   User Action: Change the macro before inserting it into the
   library.

NET

network operation failed at remote node; DAP code = 'xxxxxxxx'

   Facility: RMS, VMS Record Management Services

   Explanation: The file system of the target node could not
   perform the requested operation, and VMS RMS is unable to map
   the Data Access Protocol status code into a more specific VMS RMS
   completion code. The status value (STV) field of the FAB or RAB
   contains the DAP status code.

   User Action: Consult the appropriate DECnet manual for the remote
   node to interpret the status code and take corrective action.

NETASN

failed to declare name to network

   Facility: CNF, NI Configurator

   Explanation: An error occurred when NICONFIG attempted to declare
   itself to the network as a known object.

   User Action: See the accompanying message to determine the
   appropriate action.

unable to assign a channel to NET

   Facility: EVL, Event Logger

   Explanation: An EVL $ASSIGN system service failed to assign a
   channel to the network.

   User Action: Refer to the VMS System Services Reference Manual for
   the meaning of this system service error, and correct the problem.


NETDAS

error deassigning a channel to the device NET

   Facility: EVL, Event Logger

   Explanation: An error occurred when EVL attempted to deassign a
   channel to break a link with the event receiver.

   User Action: Refer to the VMS System Services Reference Manual for
   the meaning of this system service error, and correct the problem.

NETDIS

disconnect on remote terminal DECnet link

   Facility: REM, Set Host Facility

   Explanation: The remote terminal facility received a disconnect
   status from DECnet.

   User Action: Try again.

NETERR

DECnet channel error on remote terminal link

   Facility: REM, Set Host Facility

   Explanation: A DECnet-VAX error on the remote terminal link caused
   the connection to be broken. This message may be accompanied by
   another message identifying the specific reason why the connection
   is broken. One possible cause is an incorrect local node name or
   address. For instance, the address of the local node (the node
   from which you entered your command) may conflict with an address
   for another node in the remote node's network configuration
   database.

   User Action: Use the Network Control Program (NCP) to examine
   the status of the remote node's database. The NCP command SHOW
   displays network data, and the NCP command LOOP NODE tests data
   transmission to a specified node.

NETFAIL

network operation failed at remote node

   Facility: RMS, VMS Record Management Services

   Explanation: The requested operation could not be performed by
   the file system at the remote node. The status value (STV) field
   contains a FAL status code that describes the failure in the
   context of the remote system.

   User Action: Take corrective action based on the accompanying
   message.

NETIO

network communication error

   Facility: NCP, Network Control Program

   Explanation: A network error occurred. Information accompanying
   this message explains the reason for this error.

   User Action: The action required depends upon the accompanying
   error message. When you enter the next command, NCP automatically
   creates a new link to NML.

NETIOERR

network I/O error

   Facility: MAIL, Mail Utility

   Explanation: An I/O error occurred while transmitting a MAIL
   message with DECnet-VAX.

   User Action: Take corrective action based on the accompanying
   message.

NETLSTMSG

listing file NETPROXY.LIS complete

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The contents of the network user authorization
   file (NETPROXY.DAT) have been written to the listing file named
   NETPROXY.LIS.

   User Action: None.

NETMBX

link mailbox code

   Facility: REM, Set Host Facility

   Explanation: A remote terminal network link is broken for
   unexpected reasons.

   User Action: Refer to DECnet-VAX documentation for more
   information.

NICONFIG requires NETMBX privilege

   Facility: CNF, NI Configurator

   Explanation: NICONFIG must run with NETMBX privilege.

   User Action: Install NICONFIG with NETMBX privilege or run it from
   an account with NETMBX privilege.


NETNOBUF

NETACP-buffer allocation failure

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NETNOSTATE

NETACP-no state transition

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NETRCVPKT

NETACP-no receive I/O packet

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NETSYSSRV

NETACP-unexpected system service failure

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NETTRANCNT

NETACP-transaction count zero

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NETWORK

network

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued when operator status is
   requested either explicitly by the REPLY/STATUS command or
   implicitly as with the REPLY/ENABLE command. It indicates that
   the operator's terminal is enabled for "NETWORK" class operations.

   User Action: None.

NEWCOMPFIL

current component file

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: The name of the current startup component database
   has been changed to the file specification named. This is output
   when the /LOG qualifier is specified with the STARTUP command SET
   DATABASE.

   User Action: Verify that the named database is correct.

NEW_FILE

now analyzing file 'filename'

   Facility: AUDSRV, Audit Server

   Explanation: A new security audit journal file has been accessed
   by the Audit Analysis Utility. This message is primarily useful if
   you have used a wildcard file specification to analyze multiple
   security audit journal files.

   User Action: None. This is an informational message.

NEWFILES

'nnn' files created

   Facility: Shared by several facilities

   Explanation: The command displays the number of new files
   successfully created. This message is informational.

   User Action: None.

NEWIGNORE

security auditing resources ignored; new messages ignored

   Facility: AUDSRV, Audit Server

   Explanation: The audit server internal message buffer has been
   exhausted. As a result, the audit server has chosen to ignore a
   security alarm in an attempt to preserve the events which led up
   to this point.

   User Action: None. This event results from the server FINAL_ACTION
   setting of IGNORE_NEW.

NEWSERVERDB

new audit server database created

   Facility: AUDSRV, Audit Server

   Explanation: A new permanent audit server database
   (SYS$MANAGER:AUDIT_SERVER.DAT) has been created by the audit
   server process.

   User Action: None. This is an informational message.

NEWPAGE

attempted to write into new page

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont format
   routine indicating the attempt to write into a new page.

   User Action: None.

NEWQUEUE

new system job queue file 'filespec' created

   Facility: JBC, Job Controller

   Explanation: The system created a new system job queue file.

   User Action: This message is informational. Note, however, that
   any jobs currently entered in the old queue file have been lost.
   They have not been transferred to the newly created queue file.

NEWSAVSET

now beginning save set 'save set'

   Facility: BACKUP, Backup Utility

   Explanation: This informational message indicates the beginning of
   a new save set during a wildcard list or restore operation.

   User Action: None.

NEWTAPE

place volume 'volume' on device 'device'

   Facility: BACKUP, Backup Utility

   Explanation: The volume should be placed on the specified device.

   User Action: If the /NOASSIST qualifier is entered, the user
   should place the volume in the drive. Otherwise, the user should
   wait for the operator to do so.

NEXNOTUBA

nexus is not a UNIBUS adapter

   Facility: SYSGEN, System Generation Utility

   Explanation: This message is returned from SHOW/UNIBUS when an
   adapter other than a UNIBUS adapter is specified.

   User Action: Reenter the command with a valid UNIBUS adapter.

NEXTVOL

volume 'volume' mounted-operation continues

   Facility: BACKUP, Backup Utility

   Explanation: This is an informational message which indicates
   that the next volume required for the BACKUP operation has been
   mounted.

   User Action: None.

NIA

negative indent attempted

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You attempted to indent text to the left of the left
   margin limit of zero.

   User Action: Correct the indent or left margin setting.

NIC

another 'n' negative indents detected and accumulated. Now being
reported.

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A specific number of negative indents (to the left
   of .LM0) are detected and reported. These errors are triggered
   by DSR commands .CHAPTER or .APPENDIX, or by the end-of-file. The
   count of errors is cleared after each DSR command .CHAPTER and
   .APPENDIX, or after the end-of-file.

   User Action: Correct the indent or left margin setting.

NMF

no more files found

   Facility: RMS, VMS Record Management Services

   Explanation: The directory or volume set does not contain any more
   files that meet the file specification (wildcard operation). This
   status code is returned on a VMS RMS $SEARCH or $REMOVE operation.

   User Action: Modify the source program, if necessary, to detect
   and respond to the condition.

NMLRSP

listener response-'text'

   Facility: NCP, Network Control Program

   Explanation: The previous message line shows the format of
   response messages from the network management listener (NML). NML
   receives network management commands (from the Network Control
   Program, for instance) and performs local network management
   functions as well as control and information functions that are
   requested by remote nodes. An NML response message may be as many
   as three display lines. The first line of an NML message contains
   the reason for the error (this will be shown in the 'text' part of
   the line). The second line contains an entity code (if there is a
   code present in the response). The third line contains additional
   error text (if there is text in the response).

   User Action: Take corrective action based on the first line of the
   message.

No definition

   Facility: EDT, EDT Editor

   Explanation: You have requested a SHOW KEY definition for an
   undefined key.

   User Action: Ensure that you specify a defined key when you
   request a SHOW KEY definition.

No help available for that key

   Facility: EDT, EDT Editor

   Explanation: There is no information in the current EDT HELP file
   on the use of the key you have pressed.

   User Action: If you have another HELP file available on your
   system that contains the information, use the SET HELP command
   to gain access to that HELP file.

No more than 65,535 lines can be processed in a single command

   Facility: EDT, EDT Editor

   Explanation: You specified a range that exceeds 65535 lines.

   User Action: Reenter the command specifying a smaller range.

NO

no

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This is a prototype negative response.

   User Action: None.

No output file name

   Facility: EDT, EDT Editor

   Explanation: You have used the EDT command EXIT without having
   specified a file name, either in the EDT command EXIT or in the
   command line.

   User Action: Reenter the command specifying a file name or enter
   QUIT.

No output file written

   Facility: EDT, EDT Editor

   Explanation: You attempted to put text into an output file, but
   EDT cannot handle the record format of that text.

   User Action: You must change the record format of the file, if
   possible, before editing it.

No Path-Block During Virtual Circuit Close

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the port;
   after 50 failed attempts, it marks the device off line.

   User Action: Submit a Software Performance Report to DIGITAL
   including the error logs and the crash dumps from the local and
   remote systems.

No select range active

   Facility: EDT, EDT Editor

   Explanation: You did not create a select range prior to entering
   the EDT command APPEND or CUT.

   User Action: Create a select range (using the select key) before
   you enter the command.

No such line

   Facility: EDT, EDT Editor

   Explanation: There are no original line numbers for the specified
   range.

   User Action: Ensure that a specified range has line numbers.

NOACCESSW

no write access to virtual address 'address-value'

   Facility: DEBUG, VMS Debugger

   Explanation: A DEPOSIT, SET BREAK, or SET TRACE command specified
   the address 'address-value'. The debugger does not have write
   access to that page. The debugger requires write access to be able
   to set up breakpoints and tracepoints. You cannot do the requested
   operation without proper access.

   User Action: None.

NOACCMAN

account manipulation on alternate roots not supported.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product being installed to an alternate system
   root cannot update the user authorization file (SYSUAF).

   User Action: Do not attempt to update the user authorization file
   from an alternate system root.

NOACCPTMSG

remote node cannot accept this message format

   Facility: MAIL, Mail Utility

   Explanation: MAIL cannot send a message of this format to the
   specified remote node.

   User Action: Convert the message to text and send the message to
   the remote recipient again.

NOACESS

cannot access image section

   Facility: PATCH, Patch Utility

   Explanation: You specified an address contained in an image
   section that is not within this image file.

   User Action: Retry specifying an address contained in an image
   file.

NOACNT

operation requires ACNT privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires ACNT privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do
   not request the privilege. If you determine that you need the
   privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOACPCHAN

failure to assign ACP channel

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOACPDEV

device named by /PROCESSOR:SAME has no ACP

   Facility: MOUNT, Mount Utility

   Explanation: The /PROCESSOR qualifier requested that the ACP
   currently processing a specified device be used for another
   device, but the first device does not have an ACP.

   User Action: Reenter the command; select a different option for
   the /PROCESSOR qualifier.

NOACPMAIL

failure to create ACP mailbox

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOADAPTER

no adapter (nexus) number specified

   Facility: SYSGEN, System Generation Utility

   Explanation: The /ADAPTER qualifier must be specified in the
   SYSGEN command CONNECT.

   User Action: Reenter the command specifying the /ADAPTER
   qualifier.

NOALLOC

ignoring /ALLOCATION, not valid for output volume

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility ignored an /ALLOCATION
   qualifier, which is not meaningful.

   User Action: Leave the allocation off, it is not needed.

NOALLSPOOL

operation requires ALLSPOOL privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires ALLSPOOL privilege; the current process does not have
   this privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOALTPRI

operation requires ALTPRI privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires ALTPRI privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOANGLE

unmatched angle brackets in expression

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: You entered an expression that has an unequal number
   of right angle brackets to left angle brackets. Or the brackets
   are not correctly positioned.

   User Action: Make the number of right angle brackets equal to the
   number of left angle brackets and ensure that the brackets are in
   the correct position.

NOANSWER

no answer is detected on the phone line

   Facility: DTK, DECtalk Facility

   Explanation: The routine DTK$DIAL_PHONE was called to dial a phone
   number and no one answered the call.

   User Action: Try calling again later.

NOAQB

ACP queue header not found

   Facility: SYSTEM, VMS System Services

   Explanation: When an ACP started, it is unable to locate its queue
   header. This error is the result of running an ACP with the DCL
   command RUN.

   User Action: ACPs can be started only with the DCL command MOUNT.
   If this message results from a DCL command MOUNT, gather as much
   information as possible and submit a Software Performance Report
   (SPR).

NOAQBACP

no AQB for ACP

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOARG

missing argument for option

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You specified a qualifier without a required
   argument.

   User Action: Reenter your command and include the required
   argument.

NO_ARGS

missing arguments for substitution

   Facility: SMG, Screen Management Facility

   Explanation: You requested a capability that requires user
   arguments such as row and column numbers. You failed to provide
   those arguments.

   User Action: Check the number of arguments required by this
   capability and correct your call to SMG$GET_TERM_DATA.

NOASSIGNMENT

expression without assignment

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You used an expression without a := to assign it to a
   variable.

   User Action: Add the appropriate assignment to the statement.

NOAUTOCNF

autoconfigure all is inhibited

   Facility: SYSGEN, System Generation Utility

   Explanation: The SYSGEN parameter NOAUTOCONFG is set to one.

   User Action: Set NOAUTOCONFG to zero and reenter the command.

NOAVAIL

field 'field-name' not available in this report

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The field name entered does not apply to the
   currently selected report and therefore cannot be added to the
   Report (SPR). The name is, however, valid in a different Report
   (SPR).

   User Action: Select a different Report (SPR).

NOBACKUP

'string' data not copied, file marked NOBACKUP

   Facility: BACKUP, Backup Utility

   Explanation: A save operation is performed on a file marked
   NOBACKUP. Therefore, the file header only is saved, no data is
   transferred to the save set.

   User Action: Set file so that it can be backed up with SET FILE
   /BACKUP command or add the /IGNORE=NOBACKUP qualifier to the
   BACKUP command line.

NOBADDATA

bad block data not found on volume

   Facility: INIT, INITIALIZE Command

   Explanation: No bad block information is recorded in the Software
   or Manufacturer's Bad Block areas. You have a good disk.

   User Action: None.

bad data block not found on 'device-name'

   Facility: INIT, INITIALIZE Command and BACKUP, Backup Utility

   Explanation: This is a warning message generated by either the DCL
   command INITIALIZE or the Backup Utility; software bad block data
   is not present on the volume. The volume has been initialized with
   no bad blocks.

   User Action: Execute the Bad Block Locator Utility before using
   the volume.


NOBADINFO

no bad block information available for 'device-name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: A device that is not a last track device does not
   contain a bad block file. The utility will create a new SDBSF in
   nonlast track format.

   User Action: None.

NOBITMAP

no valid storage bit map found on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error
   during an attempt to search for the storage bit map file,
   [000000]BITMAP.SYS;1, on the specified volume. The volume cannot
   be used as a save set disk.

   User Action: Retry the operation using a properly initialized
   Files-11 Structure Level 2 volume.

NOBRANCH

instruction requires branch-type operand

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: You attempted to enter a branch-type instruction
   with an invalid operand for a destination field. For example,
   PATCH does not accept the following command: DEPOSIT/INSTRUCTION
   GO= 'BNEQ R0'. Or a DEBUG command DEPOSIT specified a branch-
   type instruction that specified an illegal addressing mode as the
   operand.

   User Action: Reenter the command using a valid branch operand in
   the destination field.

NOBREAKPOINT

no breakpoint is active

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The attempted call is valid only after a breakpoint.

   User Action: Only enter the call in response to a breakpoint.

NOBREAKS

no breakpoints are set

   Facility: DEBUG, VMS Debugger

   Explanation: The SHOW BREAK command is entered and no breakpoints
   were set.

   User Action: None.

NOBUFPCKT

required buffer packet not present

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOBUGCHK

CPU 'CPU-ID' failed to service bugcheck request

   Facility: SDA, System Dump Analyzer

   Explanation: The CPU identified by 'CPU-ID' did not save its state
   when the system failed. As a result, context information about
   this CPU is not available in the dump file.

   User Action: None.

operation requires BUGCHK privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires BUGCHK privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service calls that resulted in the error. Verify
   that you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.


NOBVPVCB

blocked volume virtual page not found in VCB

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOBYPASS

operation requires BYPASS privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires BYPASS privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOCACHE

insufficient virtual memory to allocate a new cache

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The system does not have enough memory available to
   allocate a new cache for your process.

   User Action: First, delete unneeded strings, ranges, markers,
   windows, and buffers, then reenter your command. If the error
   recurs, increase the value of the SYSGEN parameter VIRTUALPAGECNT.
   If the available memory is still insufficient for your editing
   environment, try to increase your account's page file quota.
   Finally, if the error persists, ask your system manager to
   increase available memory.

NOCALLS

no active call frames

   Facility: TRACE, Traceback Facility and DEBUG, VMS Debugger

   Explanation: There are no call frames on the stack for traceback
   to display. This message usually occurs when a user image issues
   a RET instruction that returns control to the command interpreter
   or when the DEBUG command SHOW CALLS is entered. This message is
   informational.

   User Action: None.

NOCALLUSER

could not find a routine for CALL_USER to invoke

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You must specify a routine for this built-in
   procedure to invoke.

   User Action: Provide a routine for CALL_USER to use.

NOCARRIAGE

ignoring /CARRIAGE_CONTROL, not valid for output volume

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility ignored a /CARRIAGE_CONTROL
   qualifier which could not be applied to the volume.

   User Action: Leave the qualifier off for that volume type.

NOCCAT

parameter concatenation not allowed-check use of plus (+)

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command that accepts either only a single-input
   value for a parameter or a list of input values separated by
   commas for a parameter containing multiple values separated by
   plus signs (+).

   User Action: Reenter the command with a single file specification.
   If necessary, enter the command once for each file.

NO_CHADIS

no change in virtual display

   Facility: SMG, Screen Management Facility

   Explanation: The requested number of columns to change is 0, so
   nothing in the virtual display is changed.

   User Action: None.

NOCLASS

requested input file classes not found or are incompatible

   Facility: MONITOR, Monitor Utility

   Explanation: The MONITOR request has been terminated because none
   of the requested MONITOR classes were present in a valid form in
   the specified input recording file. This situation may result from
   having specified an incorrect input file. Also, this situation
   could result from an attempt to play back classes from a recording
   file generated by a newer version of MONITOR.

   User Action: Reenter the MONITOR request, specifying only classes
   that are contained in the input recording file. Specify the
   correct input file if it had been incorrectly specified. If the
   set of classes contained in the input file is unknown, request all
   classes; only those present in the input file will be used.

NOCLASSES

no classes specified

   Facility: MONITOR, Monitor Utility

   Explanation: A MONITOR request is executed with the Monitor
   Utility command, but no information is provided to identify which
   classes to monitor.

   User Action: Reenter the Monitor Utility command, specifying at
   least one class name parameter.

NOCLI

no CLI present to perform function

   Facility: DEBUG, VMS Debugger

   Explanation: No command line interpreter exists in the target
   process. You cannot perform the attempted operation.

   User Action: None.

no CLI present to perform function

   Facility: LIB, Library Facility

   Explanation: The calling process did not have a CLI to perform the
   function or the CLI did not support the request type.

   User Action: Ensure that the calling process has a CLI and that
   the CLI supports the request type. (Note that an image run as a
   subprocess or detached process does not have a CLI.)


NOCLITABLE

image 'image-name' is not a CLI table

   Facility: CDU, Command Definition Utility

   Explanation: The input tables have an invalid format. Either an
   invalid file is entered or a valid file is entered but then became
   corrupted.

   User Action: Do not use this file again with the SET command.

NOCLUDEV

server not loaded, no cluster device

   Facility: STACONFIG, Stand-alone Configure Process

   Explanation: No port descriptor table was found on this node.
   Either there is no CI or NI adapter on this node, or the port
   drivers corresponding to either of the devices has not been
   loaded.

   User Action: Make sure the node you are loading the server on
   is configured so that it can participate in a VAXcluster. If
   it does not have either an Ethernet or a CI adapter, the MSCP
   server cannot be loaded (set MSCP_LOAD to a 0). If you have one of
   the above adapters, make sure the VAXCLUSTER parameter is set
   to a nonzero value. If the node participates in a Local Area
   VAXcluster, that NISCS_LOAD is set to 1.

NOCLUSTER

server not loaded, SCS not available

   Facility: STACONFIG, Stand-alone Configure Process

   Explanation: The SYSGEN parameters for this system request that
   the MSCP server be loaded, but none of the underlying SCS services
   are loaded. These SCS services are necessary for the operation of
   the MSCP server.

   User Action: Make sure that the VAXCLUSTER parameter is set to
   a nonzero value, or change the MSCP_LOAD parameter to 0, so the
   server is not loaded.

NOCMDMEM

no command memory has been allocated

   Facility: Shared by several facilities

   Explanation: If returned from a DR32 support routine call,
   either command memory is never allocated, or the DR32 transfer
   is complete and the memory has been deallocated.

   User Action: If the DR32 transfer has completed, this is an
   informational message. If command memory is never allocated,
   make sure the XF$SETUP support routine is called before trying
   to access command packets.

NOCMDPROC

error opening captive command procedure-access denied

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: When you attempted to log in, you were logged out
   because you have a captive account and DCL received an error
   during the login. For example, DCL could not find your LOGIN.COM
   file. You may also have incorrect protection on the system's
   SYLOGIN file (SYS$MANAGER:SYLOGIN.COM or /SYSTEM/EXEC logical).
   The system's SYLOGIN file must be protected with at least WORLD:E
   access to the file and the directory which contains it.

   User Action: See your system manager.

NOCMEXEC

operation requires CMEXEC privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires CMEXEC privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOCOMMUNICATION

unable to communicate with DNS server

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS clerk was unable to communicate with a
   clearinghouse. The error text includes VMS error information that
   may have caused the communication problem.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

NOCMK

operation requires CMKRNL privilege

   Facility: INSTALL, Install Utility

   Explanation: You must have CMKRNL privilege to perform the
   requested operation.

   User Action: Exit INSTALL and use SET/PROC/PRIV=CMKRNL.

NOCMKRNL

operation requires CMKRNL privilege

   Facility: SYSTEM, VMS System Services and JBC, Job Controller

   Explanation: A command or program requested a system function that
   required CMKRNL privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOCOMD

no command on line-reenter with alphabetic first character

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command begins with a nonalphabetic character.

   User Action: If you entered a symbol name, verify that the symbol
   is defined by using the DCL command SHOW SYMBOL, and reenter the
   command.

   If the error occurred in a command procedure, verify the syntax of
   the command lines and check for continued lines.

NOCOMMSTLEV

input files do not have a common file structure level

   Facility: MONITOR, Monitor Utility

   Explanation: A list of files is specified for the /INPUT
   qualifier, but the files had different MONITOR file structure
   levels, that is, they were created by different versions of the
   Monitor Utility. A multifile summary may be generated only when
   all the input files have the same file structure level. The file
   structure level is stored in the MONITOR file header record, and
   may be examined by using the DUMP utility.

   User Action: Reenter the MONITOR request specifying an input file
   list consisting of files that have the same file structure level.

NOCONNECT

unable to connect to remote node 'node-name'

   Facility: MONITOR, Monitor Utility

   Explanation: The network could not connect to a remote node. This
   error can occur if the specified node is unreachable when the
   CLUSTER class is requested.

   User Action: Determine whether the network is working properly on
   the remote node. When the node is accessible, reenter the MONITOR
   command.

NOCONSOLE

unknown CPU type number. Console volume cannot be remounted.

   Facility: VMSINSTAL, Install Procedures

   Explanation: While attempting to remount the console medium,
   VMSINSTAL could not determine your CPU type.

   User Action: Contact your DIGITAL field service representative.

NOCONTIG

bootfile not contiguous

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: The file SYSBOOT.EXE is noncontiguous on the
   system disk. The primitive bootstrap file system cannot read a
   noncontiguous file.

   User Action: Rebuild the system disk to obtain enough contiguous
   free space for SYSBOOT.

noncontiguous image file being written

   Facility: PATCH, Patch Utility

   Explanation: The output file is a noncontiguous image file.

   User Action: If you require a contiguous output file after you
   exit from PATCH, use the DCL command in the following format:

   COPY/CONTIGUOUS input-filespec output-filespec


NOCONVBOOT

not authorized to perform conversational bootstrap

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: Conversational bootstrap operations are not
   authorized for the satellite node.

   User Action: Consult the cluster manager.

NOCOPBAD

cannot create .BAD file with wildcard names

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility could not create an RT-11 file
   with a file type of .BAD because the input or output file names
   contained a wildcard.

   User Action: Since the file type of .BAD is given special meaning
   by RT-11, you probably want to choose a different file type for
   your file.

NOCOPBADDEL

cannot delete existing .BAD file

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility could not copy an RT-11 file
   with an file type of .BAD because the same file already exists on
   the volume.

   User Action: Since the file type of .BAD is given special meaning
   by RT-11, you probably want to choose a different file type for
   your file.

NOCOPDUP

already copied file with same output name in this command

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility did not copy the listed file,
   because the current command had already copied a file with the
   same output name.

   User Action: Copy the file with another command, specifying an
   output name which does not conflict with other files.

NOCOPLOCK

cannot create files, volume 'volume' is write-locked

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility could not perform a COPY command
   because the output volume is write-locked.

   User Action: Remount the output volume with write access, then
   reenter the command.

NOCOPNODEL

file already exists and /NODELETE requested

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility did not perform a COPY command.
   The output file already existed and the /NODELETE qualifier is
   specified.

   User Action: This message means that the /NODELETE qualifier
   actually prevented a file from being deleted. It normally requires
   no response. If it is desired to delete the original file and
   perform the copy, then reenter the command without the /NODELETE
   qualifier.

NOCOPPROT

file with same name is protected against modification

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility did not perform a COPY command.
   The output file already existed and is protected from being
   deleted.

   User Action: If it is desired to perform the copy, use the RENAME
   /NOPROTECT command to remove the protection from the output file.

NOCOPSAMDEV

illegal wildcard copy to same device

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility refused to perform a copy
   operation, due to illegal use of wildcards or the /REPLACE
   qualifier.

   User Action: EXCHANGE will not perform a wildcard copy from a
   foreign volume back to the same foreign volume, since it can be
   difficult or impossible to prevent a loop with files being copied
   more than once. It also will not perform a /REPLACE copy of a file
   to itself, since that implies deleting the file before the copy.

NOCOPSYSDEL

cannot delete existing .SYS file without /SYSTEM

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility refused to copy a file with file
   type of .SYS because an existing file of the same name would have
   to be deleted.

   User Action: If you want to delete the old file and copy the new
   file, then reenter the copy command with the /SYSTEM qualifier.

NOCOPYBOOT

unable to copy boot information

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered a problem while
   attempting a COPY /BOOT operation.

   User Action: This command will be followed by a second message
   giving the specific condition found. Take corrective action based
   on the contents of the second message.

NOCOPYBUF

cannot COPY a buffer to itself

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You attempted to copy a buffer while you were working
   in the buffer. You cannot copy a buffer to itself; doing so would
   cause an infinite loop.

   User Action: Move to another buffer before starting the copy
   operation.

NOCPUS

requested cpu[s] are not active

   Facility: MONITOR, Monitor Utility

   Explanation: The CPUs specified with the /CPU qualifier are not
   active on the requested node.

   User Action: Correct the CPU specification and reenter the MONITOR
   command.

NOCSP

no SMI thread in remote Cluster Server Process

   Facility: SMI, System Management Intergator/Server

   Explanation: A remote SYSMAN command could not be delivered to the
   SMISERVER process in the indicated node for one of the following
   reasons:

   o  The remote system is running a version of VMS lower than
      Version 5.0.

   o  The CLUSTER_SERVER process on the remote system stopped,
      aborted, or is not yet started during system initialization.

   User Action: Determine the reason for the failure and correct the
   problem.

NOCURLOC

current location not defined

   Facility: DEBUG, VMS Debugger

   Explanation: '.' is not currently defined.

   User Action: Do not reference '.' until an EXAMINE or EVALUATE
   /ADDRESS command has been performed.

NOCURRENTBUF

no buffer has been selected as default

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You tried to use a built-in procedure to modify the
   current buffer when you were not working in a buffer. This error
   occurs when no buffers have been created, because there is no
   buffer to serve as the default buffer.

   User Action: Establish a current buffer. To do this, either move
   to a buffer or associate a buffer with a window and map the window
   to the screen.

NOCURTID

no process default transaction currently defined

   Facility: SYSTEM, VMS System Services

   Explanation: The user program attempted to terminate a default
   (current) transaction when none was defined.

   User Action: Correct the program so that it specifies either a
   transaction identifier (TID) or a default transaction.

NOD

error in node name

   Facility: RMS, VMS Record Management Services

   Explanation: The node name portion of a file specification is not
   in the correct syntax.

   User Action: Check the syntax of the node name specification and
   retry the operation. Verify that the call to the VMS RMS service
   is coded correctly.

NODECODE

cannot decode instruction

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: Either the Patch Utility or the VMS Debugger
   encountered an undefined opcode or illegal addressing mode while
   attempting to decode the instruction. This can be caused by
   specifying an address that is in the middle of an instruction
   or is in a data area.

   User Action: Correct the location and reenter.

NODEDISABLED

node is not currently enable for file

   Facility: SMI, System Management Intergator/Server

   Explanation: A STARTUP DISABLE action tried to disable a component
   file on a node that the component file is not enabled on.

   User Action: None.

NODEENABLED

node is already enabled for file

   Facility: SMI, System Management Intergator/Server

   Explanation: A STARTUP ENABLE action tried to enable a component
   file on a node that the component file is already enabled on.

   User Action: None.

NODEFINITION

key 'key-name' currently has no definition

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The key you pressed is not defined.

   User Action: Use the built-in procedure DEFINE_KEY if you want to
   define a function for the key.

NODEFPWD

Warning: DEFAULT password change has no effect on added records

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The DEFAULT password for added records is always
   USER, regardless of the DEFAULT record specified.

   User Action: None.

NODEINIERR

error during node initialization

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during the initialization of a
   node. This error can occur if an attempted connection to a remote
   node fails.

   User Action: Determine whether the network is working properly on
   the remote node. When the node can be successfully initialized,
   reenter the MONITOR command.

NODELIMTR

missing or invalid instruction operand delimiter

   Facility: DEBUG, VMS Debugger

   Explanation: A DEPOSIT command specified an invalid instruction
   operand format.

   User Action: Reenter the command with valid operands.

NODELLOCK

file 'filename' not deleted, volume is write-locked

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility could not perform a DELETE
   command because the output volume is write-locked.

   User Action: Remount the output volume with write access, then
   reenter the command.

NODENOTAVAIL

requested nodes are not available

   Facility: MONITOR, Monitor Utility

   Explanation: The remote nodes specified in a MONITOR request are
   not currently accessible over the network. Therefore, they are not
   available for data collection from the local node.

   User Action: Determine why the remote nodes are not available.
   Reenter the MONITOR command when they do become accessible from
   the local node.

NODENOTCLU

node not currently in cluster

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: During a STARTUP ENABLE action, a node that is not
   currently in the cluster was specified.

   User Action: Verify that node name is correct. If it is incorrect,
   reenter the command.

NODENOTMEM

node 'node-name' is not a member of this cluster

   Facility: MONITOR, Monitor Utility

   Explanation: The requested node is not a member of the VAXcluster
   specified in the request. MONITOR can only collect data from nodes
   within a VAXcluster.

   User Action: Select nodes that are members of the requested
   VAXcluster and reenter your command.

NODENOTPRES

one or more nodes requested do not exist in input file

   Facility: MONITOR, Monitor Utility

   Explanation: At least one of the nodes requested during a playback
   command does not exist in the input file.

   User Action: Enter the command without a node name specification
   to determine which nodes are contained within the file. Then
   select the correct nodes and reenter your command.

NODERR

error returned from node "nnnnnn"

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A command returned an error on node "nnnnnn". The
   error message follows. Execution will be attempted on the next
   node in the environment.

   User Action: Take action according to the accompanying error
   message.

NODESTQUE

no such destination queue

   Facility: SYSTEM, VMS System Services

   Explanation: In a request to the symbiont manager, the specified
   destination queue does not exist.

   User Action: Reenter the command, specifying a valid destination
   queue.

NODETACH

operation requires DETACH privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires DETACH privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NODEVADAP

no devices on adapter 'n'

   Facility: SYSGEN, System Generation Utility

   Explanation: A SHOW/CONFIGURATION operation is tried on an adapter
   that has no devices.

   User Action: Reenter the command specifying an adapter that has
   devices.

NODEVAVL

device 'device-name' is not available for mounting. [optional
comment]

   Facility: MOUNT, Mount Utility

   Explanation: Someone else has allocated the device you requested.

   User Action: Abort the MOUNT and retry specifying another device.

no device available

   Facility: SYSTEM, VMS System Services

   Explanation: You tried to allocate an unavailable device.

   User Action: Wait until a device is available and retry
   allocation.


NODEVICE

missing or incorrect device name in 'command-line'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility did not find device name in a
   command line.

   User Action: Check the command for a misspelling or other error,
   and reenter the command with a correct device name.

NODEXIT

lost connection to node 'node-name'. Node removed!

   Facility: MONITOR, Monitor Utility

   Explanation: The connection to a remote node is broken. This error
   can occur if the remote node shuts down.

   User Action: Determine why the remote node is removed from the
   network. When the remote node is accessible again, reenter the
   MONITOR command.

NODIAGNOSE

operation requires DIAGNOSE privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires DIAGNOSE privilege; the current process does not have
   this privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NODIATONE

no dial tone is detected on the phone line

   Facility: DTK, DECtalk Facility

   Explanation: The routine DTK$DIAL_PHONE is called to dial a phone
   number and no dial tone is detected on the phone line.

   User Action: Correct the telephone line problem and call again.

NODIRLISM

no source directory list in effect for 'path-name'

   Facility: DEBUG, VMS Debugger

   Explanation: The command CANCEL SOURCE/MODULE='path-name' failed
   because there is no source directory search list in effect for
   module 'path-name'.

   User Action: This is an informational message. However, if the
   wrong module was specified, the command should be reentered with
   the correct name.

NODIRLIST

no source directory list in effect

   Facility: DEBUG, VMS Debugger

   Explanation: The DEBUG command CANCEL SOURCE had no effect because
   no source directory search list is currently in effect. This
   message is informational.

   User Action: None.

NODISKQUOTA

no disk quota entry for this UIC

   Facility: SYSTEM, VMS System Services

   Explanation: The specified quota file entry does not exist.

   User Action: Check the UIC given. Either add a quota file entry
   for it or use another UIC.

NODSTQUE

no such destination queue

   Facility: JBC, Job Controller

   Explanation: The specified destination queue does not exist.

   User Action: None.

NODTOOBIG

node name too long

   Facility: AUTHORIZE, Authorize Utility

   Explanation: VMS node names cannot exceed six characters. A node
   name may consist of 1 to 6 alphanumeric characters; at least one
   character must be alphabetic.

   User Action: Check the node name and reenter your command with the
   correct name.

NODUPEXC

equal-key routine and no duplicates options cannot both be specified

   Facility: SORT, Sort/Merge Utility

   Explanation: You specified both an equal-key routine and the
   SOR$M_NODUPS option when only one or the other option is allowed.

   User Action: Specify either the equal-key routine or the no
   duplicates option.

NOELEM

no element found

   Facility: STR, String Manipulation Facility

   Explanation: The input string passed to STR$ELEMENT does not
   contain at least the number of delimiters specified in the
   ELEMENT_NO item code.

   User Action: Examine SRC_DESC and ELEMENT_NO and make corrections.

NOENCODE

cannot encode instruction 'instr'

   Facility: PATCH, Patch Utility

   Explanation: The instruction contained an illegal opcode or
   operand. The branch destination may not be reachable from the
   location for which it is destined.

   User Action: Retry specifying a legal opcode or operand.

cannot encode instruction 'n'

   Facility: PATCH, Patch Utility

   Explanation: The instruction cannot be encoded. Possible causes
   include: invalid addressing modes, invalid syntax, not enough
   operands, or too many operands.

   User Action: Determine the cause of the problem.


NOEND

string beginning with 'string_value' is missing end delimiter
'delimiter_character'

   Facility: DEBUG, VMS Debugger

   Explanation: A DEPOSIT command specified an ASCII string or
   INSTRUCTION string beginning with characters 'string_value' that
   do not have a terminating apostrophe.

   User Action: Reenter the command with characters containing a
   terminating apostrophe.

NOENDOFLINE

returning a range of text with no end of line

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU is returning a range of text without an end-
   of-line indicator.

   User Action: None.

NOENTRYSYM

unable to set $ENTRY symbol to current entry number

   Facility: PRINT, PRINT Command and SUBMIT, SUBMIT Command

   Explanation: The print or submit command failed to set a global
   symbol $ENTRY. However, the actual print or submit request did
   succeed.

   User Action: Take corrective action based on the accompanying
   messages.

NOCHARREAD

no character was read by the READ_CHAR built-in

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The READ_CHAR built-in procedure did not read a
   character due to the user pressing a keypad or function key.

   User Action: None.

NOEOBSTR

cannot return a string at end of buffer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedures CURRENT_LINE and CURRENT_
   CHARACTER return the null string if you are positioned at the end
   of the buffer (EOB). This warning distinguishes this case from
   that of end of line.

   User Action: Move back from the end of the buffer.

NOEOM

module 'module-name' does not contain end of module records

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

module 'module-name' is not terminated with EOM record in 'library-
name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. The module you attempted to insert into the library does
   not contain a legal EOM record.

   User Action: Recompile the object module.

no end of module record found in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: A module did not contain an end-of-module record.

   User Action: Submit a Software Performance Report (SPR). Include
   the language compiler in the Report (SPR).



NOEPM

undefined entry mask of symbol 'symbol-name' referenced in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An entry mask of an undefined symbol is referenced
   with the MACRO .MASK directive.

   User Action: Either define the entry point or delete the reference
   to it.

NOEXQUOTA

operation requires EXQUOTA privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires EXQUOTA privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOFIELD

'field-name' is not a field in this record

   Facility: DEBUG, VMS Debugger

   Explanation: An attempt was made to reference a field that is not
   defined in the record.

   User Action: Check the field specified to ensure that it is
   defined in the record.

NOFILE

no file found

   Facility: SEARCH, SEARCH Command

   Explanation: The DCL command SEARCH is unable to open any files in
   the input file list. Therefore, no files were searched.

   User Action: If files were incorrectly specified, reenter the
   command with correct file specifications.

[new] file 'filename' does not exist.

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL cannot find an existing (or new) file with
   the given name.

   User Action: If you can determine and correct the problem,
   reinstall the product. Otherwise, contact your DIGITAL field
   service representative.


NOFILEACCESS

unable to access file 'filename'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The file you tried to open could not be accessed. The
   accompanying VMS RMS error message explains why.

   User Action: Follow the recovery procedure for the specified VMS
   RMS message.

NOFILEID

no file identification is specified

   Facility: PSM, Print Symbiont

   Explanation: This status is returned indicating no file
   identification number is specified with this request. This error
   usually indicates a problem in the creation of a batch log file.

   User Action: Correct the problem in the batch command file and
   resubmit the job.

NOFILEROUTINE

no routine specified to perform FILE I/O

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message is returned from the callable interface
   by TPU$INITIALIZE. It indicates that a valid I/O routine is not
   specified.

   User Action: Specify an I/O routine.

NOFILES

no files selected from 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: No files matched the input file selection criteria.

   User Action: Reevaluate the operation to ensure that the correct
   results are obtained.

NOFILNAM

no file specification found

   Facility: LBR, Librarian Subroutine Package

   Explanation: In the LBR$OPEN routine, the FNS argument is invalid
   or not provided or the NAM block is not filled in.

   User Action: Correct the problem before calling the routine.

NOFILPURG

no files purged for 'filespec'

   Facility: Shared by several facilities

   Explanation: No files matching the given file specification were
   candidates for purging.

   User Action: None. The directory is already purged.

NOFORCMD

account restricted - foreign commands not valid

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Foreign commands have been disabled for this account.
   (See the VMS DCL Concepts Manual for an explanation of foreign
   commands.)

   User Action: This account requires that all images are run by
   verbs defined in the CLI table (these are called DCLTABLES)
   specified for this account.

NOFORMLARG

no formal argument for .IRP/.IRPC

   Facility: MACRO, VAX MACRO Assembler

   Explanation: There were no formal arguments in an .IRP or .IRPC
   directive.

   User Action: Correct the syntax of the .IRP or .IRPC directive.

NOFREE

no free storage available

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: An internal PATCH error has occurred. Or no free
   storage is available for the debugger to execute the command.

   User Action: If this message is generated by the Patch Utility,
   submit a Software Performance Report (SPR). If this message is
   generated by the debugger, increase free storage by using the
   CANCEL MODULE command and then reenter the command.

NOGBL

some or all global symbols not accessible

   Facility: PATCH, Patch Utility

   Explanation: When you initialized PATCH, either no global symbol
   information is available to PATCH or the symbol table is not large
   enough to incorporate all the global symbol information.

   User Action: To ensure that global symbol information is passed to
   the PATCH utility, reassemble or recompile and link your program
   including the debug or traceback facility.

NOGBLSEC

no global sections created for 'filespec'

   Facility: INSTALL, Install Utility

   Explanation: When creating a known file entry for a shareable
   image, INSTALL is not able to create global sections for that
   image. The image is not shareable.

NOGBLSELDATA

no global selection data

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: There is no data in the DECwindows global selection
   region.

   User Action: Select data before attempting to paste the global
   selection into VAXTPU.

NOGBLSELOWNER

there is no global selection owner

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: There is no global selection owner.

   User Action: Make sure that an application owns the global
   selection before requesting information about it.

NOGLOBALS

some or all global symbols not accessible

   Facility: DEBUG, VMS Debugger

   Explanation: The image is linked with the /NODEBUG qualifier, and
   there are no global symbols in the symbol table.

   User Action: Relink the image with the /DEBUG qualifier.

NOGROUP

operation requires GROUP privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires GROUP privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOGRPNAM

operation requires GRPNAM privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires GRPNAM privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOGRPWILD

wildcard group numbers not allowed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Wildcard characters are not allowed in the UIC group
   number field for the command you entered.

   User Action: Reenter your command with a specific UIC group number
   instead of a wildcard character.

NOGSDREF

no GSD reference to shareable image symbol 'symbol' found in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A reference to a symbol in a shareable image is
   found in Pass 2 of the linking operation; yet, there is not a
   GSD reference to the symbol found in Pass 1.

   User Action: This is a compiler error. Submit a Software
   Performance Report (SPR). Include the appropriate compiler in
   the Report (SPR).

NOHANDLER

no condition handler found

   Facility: SYSTEM, VMS System Services

   Explanation: A request to delete an exit handler returned a
   warning code indicating that the specified handler does not exist.

   User Action: Check for a programming error.

NOHDJMT

no Head-JMT in JMT list (journaling)

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOHDRRES

compatibility mode image, 'filespec', cannot be header resident

   Facility: INSTALL, Install Utility

   Explanation: The /HEADER qualifier is ignored. Resident headers
   are not used with compatibility mode images.

   User Action: None. The known file entry is successfully created.

NOHIDDEN

cannot modify hidden ACEs

   Facility: SET, SET Facility

   Explanation: The ACE currently being added or replaced has the
   HIDDEN option set.

   User Action: Remove the HIDDEN option before attempting to add the
   ACE.

NOHISTORY

library has no update history

   Facility: LBR, Librarian Subroutine Package

   Explanation: This library is created with the maximum number of
   history records equal to zero.

   User Action: None.

NOHLPLIBS

no default help libraries can be opened

   Facility: LBR, Librarian Subroutine Package

   Explanation: You called LBR$OUTPUT_HELP without passing the name
   of a help library, and you have no default libraries defined.

   User Action: Either pass in the name of the library or define
   HLP$LIBRARY to be a library name.

NOHLPTXT

help text not found

   Facility: LBR, Librarian Subroutine Package

   Explanation: There is no help text associated with the specified
   key path.

   User Action: Check that the help module is properly formatted.

no level 1 help text found in 'input filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The specified input file does not contain a properly
   formatted help file.

   User Action: Reformat the help file before reentering the command
   line.


NOHOME

volume does not contain a valid home block

   Facility: SET, SET Facility

   Explanation: You attempted to perform a SET VOLUME on a disk that
   is not Files-11.

   User Action: None. You cannot perform a SET VOLUME on a disk that
   is not Files-11.

NOHOMEBLK

Files-11 home block not found on volume

   Facility: SYSTEM, VMS System Services

   Explanation: Either the volume is not a Files-11 volume or it is
   completely unreadable.

   User Action: Verify that the correct volume is mounted. Mount the
   volume as foreign.

no valid home block found on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to search for the Files-11 home block on the specified
   volume. The volume cannot be used as a save set disk.

   User Action: Retry the operation using a properly initialized
   Files-11 Structure Level 2 volume.


NOIDNAM

no ID name is specified

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The command you entered requires that you include an
   identifier name.

   User Action: Check the VMS Authorize Utility Manual for the syntax
   rules regarding identifier names for the command you want to use.
   Then reenter the command including an identifier name.

NOIMGFIL

image file not created

   Facility: LINK, Linker Utility

   Explanation: This secondary message is issued when the linker
   encounters an error that prevents the generation of an image file.

   User Action: None.

NOINDEX

no index information in file 'filename'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: The indicated file does not contain any index
   entries.

   User Action: Check the corresponding input file to be sure there
   are index entries.

NOINDEXF

no valid index file header found on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to search for the index file, [000000]INDEXF.SYS;1, on the
   specified volume. The volume cannot be used as a save set disk.

   User Action: Retry the operation using a properly initialized
   Files-11 Structure Level 2 volume.

NOINIT

PPL$INITIALIZE is not called

   Facility: PPL, Parallel Processing Facility

   Explanation: PPL$INITIALIZE must be called before this routine.

   User Action: Recode your program to ensure that calls are in the
   correct order. PPL$INITIALIZE is performed automatically for most
   calls, but not for those calls that require the prior creation of
   an element.

NOINPFILES

no usable input files

   Facility: MONITOR, Monitor Utility

   Explanation: A multifile summary is requested but none of the
   files specified in the /INPUT list could be used.

   User Action: Examine the IGNFIL error messages preceding this
   message. Each one identifies a file which is ignored, and provides
   an accompanying message explaining why the file could not be used.
   Reenter the MONITOR request specifying at least one input file
   which can be used. A typical situation where input files are
   ignored is one where the /BEGINNING and/or /ENDING qualifiers
   are specified, and the ignored files do not contain data in the
   range of the requested time.

NOINPTAB

new tables file cannot be written unless input tables supplied

   Facility: CDU, Command Definition Utility

   Explanation: You tried to write empty tables to your process.
   Either you did not provide input tables or you specified the
   /TABLES qualifier in the command string and there were no CLD
   files.

   User Action: Include the name of the input tables in the command
   string. Or if there are no CLD files, do not specify the /TABLES
   qualifier in the command string.

NOINSTRAN

cannot translate instruction

   Facility: SDA, System Dump Analyzer

   Explanation: SDA cannot translate the specified instruction into
   VAX MACRO instruction format.

   User Action: None.

cannot translate opcode at location 'address-value'

   Facility: DEBUG, VMS Debugger

   Explanation: The address specified in the EXAMINE command is not
   the beginning of a valid VAX instruction. This can be caused by
   specifying an address that is in the middle of an instruction or
   by an address that is in a data area.

   User Action: Specify an address that contains a valid instruction.


NOINTABLE

an output table image must be created using an input table

   Facility: CDU, Command Definition Utility

   Explanation: You tried to write empty tables to your process.
   Either you did not provide input tables or you specified the
   /TABLES qualifier in the command string and there were no CLD
   files.

   User Action: Include the name of the input tables in the command
   string. Or, if there are no CLD files, do not specify the /TABLES
   qualifier in the command string.

NOIOCHAN

cannot piggyback I/O channel with PUTMSG

   Facility: TRACE, Traceback Facility

   Explanation: This message is associated with a traceback internal
   consistency check.

   User Action: Submit a Software Performance Report (SPR).

no I/O channel available

   Facility: SYSTEM, VMS System Services

   Explanation: The process exceeds the number of I/O channels that
   can be assigned at one time.

   User Action: Deassign another channel, or close a file and
   retry the operation. Check for a program error that fails to
   deassign channels or close files. Also check the SYSGEN parameter
   CHANNELCNT to see if it is high enough.


NOJOBCTX

no job context

   Facility: JBC, Job Controller

   Explanation: A call was made to the $GETQUI system service
   requesting the $QUI_DISPLAY_FILE function without first
   establishing a job context for this call.

   User Action: Modify the application to first
   establish a job context by calling the $GETQUI
   system service in wildcard mode using either the
   QUI$_DISPLAY_JOB or the QUI$_DISPLAY_ENTRY function codes.

NOJOBID

job 'nnn' not found in 'queue-name' queue

   Facility: Shared by several facilities

   Explanation: A request to modify or delete a job failed because
   the job does not exist. The message identifies the job by job
   name or job identification number, depending on the command
   specification.

   User Action: Verify that the job identification number or job
   name is entered correctly. If it is not, reenter the command
   with the correct job identification number or job name. If the
   job identification number or job name is correct, this message
   indicates that the job is no longer in the queue; that is, the job
   has already been processed or is currently being processed.

NOJOBNAME

job 'job-name' not found in 'queue-name' queue

   Facility: Shared by several facilities

   Explanation: A request to modify or delete a job failed because
   the job does not exist. The message identifies the job by job
   name or job identification number, depending on the command
   specification.

   User Action: Verify that the job identification number or job
   name is entered correctly. If it is not, reenter the command
   with the correct job identification number or job name. If the
   job identification number or job name is correct, this message
   indicates that the job is no longer in the queue; that is, the job
   has already been processed or is currently being processed.

NOJOURNAL

editing session is not being journaled

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: VAXTPU is invoked without opening a journal file.

   User Action: If you want to open a journal file, use the built-in
   procedure JOURNAL_OPEN.

NOKEY

no such key

   Facility: CONVERT, Convert Utility

   Explanation: You have specified a legal but nonexistent value
   with /KEY. For example, if the file has two keys, 0 and 1, and you
   specify /KEY=2, you will receive this error message.

   User Action: Specify a valid number with /KEY.

NOKEYMAP

attempt to access an undefined key map 'key-map-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are referring to a key map that has not yet been
   created.

   User Action: Enter the built-in procedure SHOW (KEY_MAPS) on the
   command line to obtain the names of valid key maps.

NOKEYMAPLIST

attempt to access an undefined key-map list 'key-map-list-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are referring to a key-map list that has not yet
   been created.

   User Action: Enter the built-in procedure SHOW (KEY_MAPS_LISTS) on
   the command line for a list of valid key-map list names.

NOKEYW

qualifier name is missing-append the name to the slash

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A slash character (/)  is present on a command but is
   not followed by a qualifier keyword name.

   User Action: Reenter the command specifying the qualifier or
   removing the slash.

NOKFEFND

known file entry not found

   Facility: INSTALL, Install Utility

   Explanation: There is no known file entry in the known file list
   for the file you want to create, replace, or list.

   User Action: Use /LIST to find out what entries are in the file
   list.

NOLASTVAL

last value is not defined

   Facility: DEBUG, VMS Debugger

   Explanation: '\' is not currently defined.

   User Action: Do not reference '\' until a DEPOSIT or EVALUATE
   command has been performed.

NOLBLS

label ignored-use only within command procedures

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This message is output if you try to put a label on
   a command line that is supplied to DCL interactively. Labels are
   not appropriate in this context and are ignored. Any command that
   follows the label will be executed.

   User Action: None.

NOLCL

image does not contain local symbols

   Facility: PATCH, Patch Utility

   Explanation: When you initialized PATCH, no local symbol
   information is available to PATCH.

   User Action: To ensure that local symbol information is passed to
   PATCH, reassemble or recompile and link your program including the
   DEBUG or Traceback Facility.

NOLICENSE

operation requires software license

   Facility: SYSTEM, VMS System Services

   Explanation: You are requesting a function that requires a
   software license. This function cannot be done until the license
   kit is installed. (DECnet-VAX is the only software license that is
   currently associated with this message.)

   User Action: Buy the license and install the license kit.

NOLINK

specified link has not been defined.

   Facility: LATCP, LAT Control Program

   Explanation: The specified link is not defined, or a link name is
   required and is not specified.

   User Action: Ensure that the link exists on your service node and
   reenter the command.

NOLINKS

no slots in logical link vector

   Facility: SYSTEM, VMS System Services

   Explanation: The maximum number of allowable logical network links
   exists and no more slots are available to establish another link.

   User Action: Wait and retry the request later. If the problem
   persists, ask the system manager to increase the allowed number of
   logical links. Or, if you have SYSPRV, you could run the Network
   Control Program (NCP) and change the number of maximum allowable
   links yourself. To increase the number of allowable links, use
   the NCP command SET EXECUTOR MAXIMUM LINKS n, where the valid
   range for n is between 1 and 960, unless the ALIAS MAXIMUM LINKS
   parameter is also specified, in which case the valid range is
   between 1 and 512. A reasonable range for maximum links on most
   networks is between 25 and 50.

NOLINXXX

lines 'xxx:yyy' do not exist

   Facility: DEBUG, VMS Debugger

   Explanation: The line number range 'xxx:yyy' specified on the
   DEBUG command TYPE does not exist. There are no such line numbers
   in the specified module (or the default module).

   User Action: Reenter the command specifying line numbers that do
   exist.

NOLIST

list of parameter values not allowed-check use of comma (,)

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command that accepts only a single input value for
   a parameter contains multiple values separated by commas (,).

   User Action: Reenter the command; specify only one file. If
   necessary, enter the command once for each file specified.

parameter list not allowed

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: The command does not accept a list of parameters.

   User Action: Eliminate the parameter list.

there is no known file entry List

   Facility: INSTALL, Install Utility

   Explanation: The known file entry list is not created. Therefore,
   LIST, DELETE, REMOVE, and PURGE will have no effect.

   User Action: None. The list is created automatically when the
   first known file is created with the ADD, CREATE, or REPLACE
   commands.



NOLISTENER

specified remote system process not listening

   Facility: SYSTEM, VMS System Services

   Explanation: A system facility attempted to connect to a remote
   process that is not enabled for connections.

   User Action: Ensure that the remote process is receiving
   connections.

NOLITERAL

no LITERAL translation exists for 'xx'

   Facility: PATCH, Patch Utility, or DEBUG, VMS Debugger

   Explanation: If the Patch Utility generated this message, the
   value represented as 'xx' does not have a symbolic equivalent
   associated with it. Either there is no name for 'xx' or the
   symbolic names were not included at compile or link time. If the
   debugger generated this message, the command attempted to find
   a literal translation for a value. The debugger does not support
   this operation.

   User Action: If the Patch Utility generated this message, ensure
   that local symbol information is passed to PATCH, by reassembling
   or recompiling and linking your program including the DEBUG or
   Traceback Facility.

NOLOAD

network and sequentially loaded files are not installable

   Facility: INSTALL, Install Utility

   Explanation: Known file entries cannot be created for files that
   are stored on magnetic tape or that are accessible through a
   network.

   User Action: Transfer the file to a disk and then install it.

NOLOCALS

image does not contain local symbols

   Facility: DEBUG, VMS Debugger

   Explanation: All the modules in the image were compiled or
   assembled without traceback information. There is no local symbol
   information in the image.

   User Action: Recompile or reassemble the modules using the /DEBUG
   qualifier and then relink them.

NOLOCKID

no lock id, available

   Facility: SYSTEM, VMS System Services

   Explanation: The system's lock identification table is full when
   an $ENQ system service request is attempted.

   User Action: Either retry the program or increase the size of
   the lock id table by increasing the value of the SYSGEN parameter
   LOCKIDTBL.

NOLOGNAM

no logical name match

   Facility: SYSTEM, VMS System Services

   Explanation: A specified logical name does not exist or cannot be
   deleted by the current access mode.

   User Action: Check for a programming error. Verify the spelling of
   the logical name.

NOLOGTAB

no logical name table match

   Facility: SYSTEM, VMS System Services

   Explanation: The specified logical name does not exist.

   User Action: Check for a programming error. Verify the spelling of
   the logical name table.

NOLOWVER

no lower version of file 'filespec' found

   Facility: DIFF, DIFFERENCES Command

   Explanation: The Differences Utility cannot default the revision
   file specification because no lower version of the master file
   exists.

   User Action: Check that the file exists. Reenter the command,
   explicitly specifying the revision file specification.

NOMACFOUND

no .MACRO found in 'input-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The specified input file does not contain a properly
   formatted macro.

   User Action: Reformat the macro source file.

NOMALFUN1

no malfunctions detected since power up

   Facility: DTK, DECtalk Facility

   Explanation: This is an informational message telling you that no
   malfunctions occurred since the DECtalk device was turned on. This
   is the first reply.

   User Action: None.

NOMALFUN2

no malfunctions detected since power up

   Facility: DTK, DECtalk Facility

   Explanation: This is an informational message telling you that no
   malfunctions occurred since the DECtalk device was turned on. This
   is the second or later reply.

   User Action: None.

NOMATCH

'filespec'-'xxx' records

   Facility: SEARCH, SEARCH Command

   Explanation: This message displays the name of the file and the
   number of records searched. The search strings were not found in
   the file. This message is informational.

   User Action: None.

no match found against input string

   Facility: STR, String Manipulation Facility

   Explanation: There is no match found for the input string that is
   passed to the routine.

   User Action: None.


NOMATCHES

no strings matched

   Facility: SEARCH, SEARCH Command

   Explanation: The search operation is able to open and search one
   or more files, but the files did not contain the search strings.
   This message is informational.

   User Action: None.

NOMATCHFOU

no match found

   Facility: LBR, Librarian Subroutine Package

   Explanation: The specified module does not appear in the module
   name table.

   User Action: Ensure that the module exists in the current library.

NOMBX

no associated mailbox for inbound connects

   Facility: SYSTEM, VMS System Services

   Explanation: A channel specified for network operations does not
   have a mailbox associated with it.

   User Action: Correct the source program to create a mailbox, and
   associate the mailbox with the channel on the assign request.

NOMCHKFRAME

no machine check frame for CPU nn

   Facility: SDA, System Dump Analyzer

   Explanation: The machine check frame for CPU nn does not contain
   any valid information.

   User Action: None.

NOMEMBER

specified node has left cluster

   Facility: SMI, System Management Intergator/Server

   Explanation: The cluster configuration changed while processing
   a SYSMAN command. The command continues on the next node in the
   environment.

   User Action: None.

NOMODNAM

no module name found for 'input filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: An attempt is made to insert unnamed text modules
   into a text library.

   User Action: Use the /MODULE qualifier to name the text modules.

NOMODS

no input modules specified (or found)

   Facility: LINK, Linker Utility

   Explanation: The command line did not specify any input modules.

   User Action: Reenter the command, specifying some modules to link.

no modification made

   Facility: CDU, Command Definition Utility

   Explanation: The process tables were not modified because a CLD
   file is not entered in the command string.

   User Action: Add CLD file to the command string.

no modifications made to system authorization file

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This is an informational message.

   User Action: None.



NOMORE

wildcard request complete

   Facility: DEBUG, VMS Debugger

   Explanation: This is a debugger internal error code.

   User Action: Submit a Software Performance Report (SPR).

NOMORECHAR

no more characteristics found

   Facility: JBC, Job Controller

   Explanation: No more characteristics exist that match a wildcard
   name specified for the QUI$_DISPLAY_CHARACTERISTICS function of
   the $GETQUI system service. This condition indicates that at least
   one match had been found in previous calls during the wildcard
   search for characteristics.

   User Action: Note the condition and, if necessary, modify the
   source program to detect and respond to the condition.

NOMOREENT

no more entries found

   Facility: JBC, Job Controller

   Explanation: No more job entries exist for the specified user
   name. This condition is returned for the QUI$_DISPLAY_ENTRY
   function of a call to the $GETQUI system service. It indicates
   that at least one entry had been found in previous calls during
   the wildcard search for entries.

   User Action: Note the condition and, if necessary, modify the
   source program to detect and respond to the condition.

NOMOREFILE

no more files found

   Facility: JBC, Job Controller

   Explanation: No more files for the specified batch or print job
   exist. This condition is returned for the QUI$_DISPLAY_FILE
   function of a call to the $GETQUI system service. It indicates
   that at least one file had been found in previous calls during the
   wildcard search for files.

   User Action: Note the condition and, if necessary, modify the
   source program to detect and respond to the condition.

NOMOREFILES

no more files

   Facility: SYSTEM, VMS System Services

   Explanation: No more files match a wildcard in a file
   specification string. At least one match is found.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

NOMOREFORM

no more forms found

   Facility: JBC, Job Controller

   Explanation: No more forms match a wildcard name specified for the
   QUI$_DISPLAY_FORM function of the $GETQUI system service. This
   condition indicates that at least one match had been found in
   previous calls during the wildcard search for forms.

   User Action: Note the condition and, if necessary, modify the
   source program to detect and respond to the condition.

NOMOREITEMS

no more items to be returned

   Facility: SYSTEM, VMS System Services

   Explanation: A request dealing with a wildcard list was completed
   and there are no additional items to be returned. This is an
   informational message.

   User Action: None.

no more items in message

   Facility: SMB, Symbiont Services

   Explanation: This value is returned by the SMB$READ_MESSAGE
   routine indicating no items remain on the list.

   User Action: Note the condition and, if necessary, modify the
   source code to detect the condition.


NOMOREJOB

no more jobs found

   Facility: JBC, Job Controller

   Explanation: No more jobs for the specified batch or print queue
   exist. This condition is returned for the QUI$_DISPLAY_JOB
   function of a call to the $GETQUI system service. It indicates
   that at least one job had been found in previous calls during the
   wildcard search for jobs.

   User Action: Note the condition and, if necessary, modify the
   source program to detect and respond to the condition.

NOMOREKEYS

no more keys defined

   Facility: SMG, Screen Management Facility

   Explanation: SMG$LIST_KEY_DEFS, when called repeatedly, returns
   all the key definitions in a key table. When there are no more
   definitions, this error is returned.

   User Action: Modify your program to expect this condition, if
   necessary.

NOMOREMSG

no more messages

   Facility: MAIL, Mail Utility

   Explanation: You have no more messages to read.

   User Action: If you want to read your messages again, enter the
   MAIL command READ; otherwise, no action is required.

NOMOREPROC

no more processes

   Facility: SYSTEM, VMS System Services

   Explanation: The search for processes is complete.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

NOMOREQUE

no more queues found

   Facility: JBC, Job Controller

   Explanation: No more queues match a wildcard name specified for
   the QUI$_DISPLAY_QUEUE function of the $GETQUI system service.
   This condition indicates that at least one match had been found in
   previous calls during the wildcard search for queues.

   User Action: Note the condition and, if necessary, modify the
   source program to detect and respond to the condition.

NO_MORMSG

no more broadcast messages are available

   Facility: SMG, Screen Management Facility

   Explanation: A call to SMG$GET_BROADCAST_MESSAGE found that there
   are no more messages to be obtained.

   User Action: None.

NOMP

qualifier only valid for multiprocessor systems

   Facility: Shared by several facilities

   Explanation: This error is returned when the system is not running
   in a multiprocessor configuration.

   User Action: None.

NOMSGS

no messages

   Facility: MAIL, Mail Utility

   Explanation: There are no mail messages.

   User Action: None.

no messages defined

   Facility: MESSAGE, Message Utility

   Explanation: No messages have been defined in the message source
   file.

   User Action: Ensure that at least one message definition appears
   in the message source file.


NOMTCHENDM

no matching .ENDM for macro 'macro-name' in library 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The specified macro does not contain a matching .ENDM
   line.

   User Action: Reformat the macro source file.

NOMTCHENDR

'location' missing .ENDR for macro 'macro-name' in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The Librarian Utility found a matching .ENDM before
   the required .ENDR.

   User Action: Correct the macro source file.

NOMTCHFOU

no match found

   Facility: LBR, Librarian Subroutine Package

   Explanation: The specified module does not appear in the Module
   Name Table (MNT).

   User Action: Ensure that the module exists in the current library.

no matches found for 'module-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The module specified with the /ONLY qualifier is not
   in the Module Name Table (MNT).

   User Action: Ensure that the specified module exists.


NOMULTBK

ACP multiple block buffering not supported yet

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NONAMES

there are no names matching the one requested

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedure EXPAND_NAME cannot find any
   names matching the one you requested.

   User Action: None.

NONANSICRT

SYS$INPUT must be a supported CRT

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You ran VAXTPU with SYS$INPUT associated with a
   terminal that does not have the appropriate characteristics,
   or you ran VAXTPU from a command procedure without assigning
   SYS$INPUT to SYS$COMMAND.

   User Action: Run VAXTPU from a supported device or use the
   /NODISPLAY command qualifier. In a command procedure, assign
   SYS$INPUT to SYS$COMMAND before invoking VAXTPU.

NONBRDMSG

nonbroadcast message returned

   Facility: SMG, Screen Management Facility

   Explanation: A call to SMG$GET_BROADCAST_MESSAGE found that a
   nonbroadcast message was returned.

   User Action: None.

NONCONTIG

'filename' is not contiguous due to insufficient contiguous space

   Facility: PATCH, Patch Utility, BACKUP, Backup Utility

   Explanation: The specified file is originally allocated contiguous
   blocks. However, because the output volume lacked enough space
   for contiguous blocks, the file has been allocated noncontiguous
   blocks.

   User Action: If necessary, reorganize the volume to free a
   sufficient number of contiguous blocks and reenter the command.

noncontiguous image file being written

   Facility: PATCH, Patch Utility

   Explanation: The image file being written by PATCH is not
   contiguous. This error may be relevant to device drivers.

   User Action: None.


NONEDEL

no files processed on deletion pass

   Facility: BACKUP, Backup Utility

   Explanation: BACKUP did not process any files in the deletion
   pass. That is, no files were deleted by the BACKUP operation.

   User Action: None.

NONEFOUND

no folders found in file 'filename' with a folder name greater than
'filename'

   Facility: MAIL, Mail Utility

   Explanation: User entered a DIR/FOLDER/START=string command,
   but there were no folders found alphabetically higher than the
   specified string.

   User Action: None.

NONEREC

no files processed on recording pass

   Facility: BACKUP, Backup Utility

   Explanation: BACKUP did not process any files in the recording
   pass. That is, no files had their backup date updated by the
   BACKUP operation.

   User Action: None.

NONET

network unavailable

   Facility: SHOW, SHOW Command

   Explanation: The network is unavailable.

   User Action: None.

NONETMBX

operation requires NETMBX privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires NETMBX privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NONEWMAIL

no new messages

   Facility: MAIL, Mail Utility

   Explanation: User has requested a READ/NEW, DIR/NEW, or SELECT/NEW
   command and there is no new (unread) mail.

   User Action: None.

NONEXDRV

nonexistent drive

   Facility: SYSTEM, VMS System Services

   Explanation: The drive specified in an I/O request either does not
   exist or the drive select plug is removed.

   User Action: Verify the availability and status of the device.
   Also, check the source program for errors.

NONEXIST

authorization file does not exist

   Facility: CAF, Cluster Authorization File Service

   Explanation: A SYSMAN CONFIGURATION SHOW CLUSTER_AUTHORIZATION
   command has been entered and SYS$SYSTEM:CLUSTER_AUTHORIZE.DAT does
   not exist.

   User Action: Create the file on all the cluster members with a
   CONFIGURATION SET CLUSTER_AUTHORIZATION command at the SYSMAN>
   prompt.

NONEXISTBUF

buffer 'buffer-name' does not exist

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The buffer that you are trying to use has not been
   created.

   User Action: Use a current buffer or create a new one.

NONEXPR

nonexistent process

   Facility: DEBUG, VMS Debugger

   Explanation: A process name or a process identification specified
   in a command is not valid.

   User Action: Verify that the process name or identification is
   correct and that the process is not already deleted. Also verify
   that you have the required privilege to access the process.

nonexistent process

   Facility: SYSTEM, VMS System Services

   Explanation: A process name or process identification specified in
   a command or system service request is not valid.

   User Action: Verify that the process name or identification is
   correct and that the process is not already deleted. If a process
   name is entered, the process must be in the same group.


NONEXSTACP

Nonexistent ACP process

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NONLOCAL

device is not a local device

   Facility: SYSTEM, VMS System Services, MOUNT, Mount Utility and
   INIT, INITIALIZE Command

   Explanation: The device name specified in a command or program
   request is not a local device; that is, the device name contains a
   network node name.

   User Action: Verify the device name (or logical name, if a logical
   name is specified), and reenter the command specifying a device in
   the host system.

NONODE

node name has not been initialized

   Facility: LATCP, LAT Control Program

   Explanation: You attempted to start the LAT port driver without
   setting up a proper LAT node name.

   User Action:

   1. Define your node name in one of the following ways:

      o  Equate your node name to the logical name SYS$NODE.

      o  Use the SET NODE command.

      o  Use the START NODE command.

   2. Start the LAT port driver again.

NONPHYSET

nonphysical save set supplied to physical operation

   Facility: BACKUP, Backup Utility

   Explanation: A save set created without the /PHYSICAL qualifier is
   used as input to an operation with the /PHYSICAL qualifier.

   User Action: Use the BACKUP/LIST command to determine how the save
   set is created. Reevaluate the operation and reenter the command.

NONPIC

cannot map section AS to same addresses as others mapped it

   Facility: PPL, Parallel Processing Facility

   Explanation: PPL cannot map requested address space to the same
   addresses in all processes.

   User Action: If it is critical to the application that the
   requested space appear at the same addresses in all processes,
   the user must take steps to ensure that enough space is made
   available. This may require increasing system quotas or reserving
   the required addresses through link time operations.

NONPICDAT

'number' relocatable address references in 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: This message informs you of the number of .ADDRESS
   fixups to be done in each module by the image activator at run
   time. It is issued only if a full map is requested.

   User Action: None.

NONPICIMG

shareable image 'image-name' is non-position-independent

   Facility: LINK, Linker Utility

   Explanation: While building a position-independent shareable
   image, a shareable image is input that is not position-
   independent. The shareable image being created is also built
   non-position-independent.

   User Action: None. If possible, rebuild the non-position-
   independent shareable image so that it is position-independent.

NONPICREF

failure to use .ADDRESS for relocatable data in psect 'psect-name'
offset 'number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A reference is made to relocatable data using other
   than the MACRO .ADDRESS directive in a shareable image.

   User Action: Use the MACRO .ADDRESS directive in reference to
   relocatable data; otherwise, the image will be position-dependent.

NONSMPDRV

non SMP driver cannot be loaded

   Facility: SYSGEN, System Generation Utility

   Explanation: SYSGEN cannot load this driver because the driver has
   not been modified to support symmetric multiprocessing (SMP).

   User Action: Modify the driver to conform to symmetric
   multiprocessing requirements, or turn off SMP.

NONSTDUNI

unibus/qbus 'device-name' in nonstandard configuration

   Facility: SYSGEN, System Generation Utility

   Explanation: The vector on the device specified in the message
   needs to be reconfigured.

   User Action: Call your DIGITAL field service representative.

NONXTLIN

next line for source display not defined

   Facility: DEBUG, VMS Debugger

   Explanation: The DEBUG command TYPE or SEARCH is entered without
   specifying a line number (for example, the next line after the
   last source line printed should be used). But no next source line
   is currently defined.

   User Action: Reenter the command explicitly specifying the desired
   line number.

NOONE_ENABLED

no one presently enabled for event notification

   Facility: PPL, Parallel Processing Facility

   Explanation: Event trigger is successfully queued, and no one is
   presently enabled to receive it. The first caller to enable the
   trigger will receive it.

   User Action: Continue normally.

NOOPCOM

OPCOM not running at 'time'; security alarms may be lost

   Facility: AUDSRV, Audit Server

   Explanation: The audit server detects that the Operator
   Communications Process (OPCOM) is not running.

   User Action: From the SYSTEM account, start OPCOM using the DCL
   command @SYS$SYSTEM:STARTUP OPCOM.

NOOPENJOB

no open job for requesting process

   Facility: JBC, Job Controller

   Explanation: The requesting process did not open a job with the
   SJC$_CREATE_JOB function prior to making the current $SNDJBC
   request, or did not open a job with the SMR$K_CREJOB function
   prior to making the current $SNDSMB request.

   User Action: Modify the program to open a job first.

NOOPER

no operator is available to handle the request

   Facility: BACKUP, Backup Utility

   Explanation: There are no operator terminals enabled to handle
   this request.

   User Action: Either service the request yourself or abort the
   request. To ensure that no operator intervention is required in a
   BACKUP operation, specify the /NOASSIST qualifier on the command
   line.

OPER privilege required on all nodes, access rejected

   Facility: SMI, System Management Intergator/Server

   Explanation: OPER privilege is required to run SYSMAN. If
   any nonlocal environment is used, OPER privilege must also be
   authorized in the UAF on each remote node.

   User Action: Correct the authorized privileges in the associated
   UAF files.

SYSMAN requires OPER privilege

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: You are required to have OPER privilege.

   User Action: Enter a SET PROCESS/PRIVILEGE=OPER command from the
   DCL level before entering SYSMAN commands.

operation requires OPER privilege

   Facility: SYSTEM, VMS System Services and JBC, Job Controller

   Explanation: A command or program requested a system function that
   requires OPER privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privilege function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.




NOOPR

no operator available to service request

   Facility: MOUNT, Mount Utility

   Explanation: There is no operator present to service the request.

   User Action: You can either service the request yourself or abort
   the request.

NOOPRND

missing operand in expression

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: One or more operands were omitted from the
   expression.

   User Action: Add the correct number of operands and retry.

NOOUTPUT

no output selected . . . specify /DISPLAY, /RECORD, or /SUMMARY

   Facility: MONITOR, Monitor Utility

   Explanation: The MONITOR request selected (explicitly or
   implicitly) none of the three possible output types (DISPLAY,
   RECORD, SUMMARY).

   User Action: Reenter the MONITOR request, specifying any
   combination of the qualifiers: /DISPLAY, /RECORD, or /SUMMARY.

NOOUTQUAL

the /SHOW qualifier is invalid without specifing the /OUTPUT
qualifier

   Facility: BAD, Bad Block Locator Utility

   Explanation: The /SHOW qualifier is specified without specifying
   the /OUTPUT qualifier.

   User Action: Specify the /OUTPUT qualifier with the /SHOW
   qualifier in the command.

NOP1VA

P1 space not supported in shareable images

   Facility: SYSTEM, VMS System Services

   Explanation: P1 space is not supported in shareable images.

   User Action: Relink the image, positioning all binary data in P0
   space.

NOPAGEDYN

unable to allocate enough paged dynamic memory

   Facility: INSTALL, Install Utility

   Explanation: INSTALL cannot complete the operation because paged
   dynamic memory is not accessible.

   User Action: Contact your system manager.

NOPARAM

no such parameter

   Facility: SYSGEN, System Generation Utility and SYSBOOT, System
   Bootstrap Facility

   Explanation: The parameter name specified in a SET or SHOW command
   is not valid.

   User Action: Reenter the command specifying a valid parameter
   name.

NOPAREN

value improperly delimited-supply parenthesis

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A value supplied as part of a parenthesized
   value list for a parameter, qualifier, or keyword is missing a
   delimiting parenthesis.

   User Action: Reenter the command with the missing parenthesis.

NOPARENT

there is no parent process to attach

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The current process is the top-level process. There
   is no parent process.

   User Action: None. Without a parent process there is nothing to
   attach to.

there is no parent to which to attach

   Facility: MAIL, Mail Utility

   Explanation: User specified an ATTACH/PARENT command, and the
   current process is not a subprocess. The ATTACH/PARENT command is
   only legal in a subprocess.

   User Action: None.


NOPARM

either a parameter name or group qualifier is required

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A PARAMETERS SHOW command must include either a
   parameter name to be displayed or a qualifier specifying a
   parameter group.

   User Action: Respecify the command with a parameter name or group
   qualifier.

no parameters

   Facility: NCP, Network Control Program

   Explanation: No parameters were specified for a command.

   User Action: Reenter the command with parameters.


NOPASS

need remote password and SYS$COMMAND not a terminal

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: An environment that requires an access-control
   password and SYSMAN is not being run interactively. A password
   can only be read when SYS$COMMAND is a terminal device.

   User Action: Rerun SYSMAN interactively.

NOPASSWORD

password must be supplied

   Facility: MOM, Maintenance Operation Module

   Explanation: In this LOOP NODE or LOOP EXECUTOR command, a
   password must be supplied.

   User Action: Supply a password with the LOOP command.

NOPATAREA

insufficient patch area at 'addr', size = 'nn'

   Facility: PATCH, Patch Utility

   Explanation: The current user-defined patch area is not large
   enough to store the given code.

   User Action: Use the default patch area or an alternate user-
   defined patch area of a larger size.

NOPE

permanent qualifier not specified

   Facility: Shared by several facilities

   Explanation: You tried to set a terminal characteristic for a
   terminal that is not allocated to a user process. The default
   action of the DCL command SET TERMINAL is to set a specified
   terminal characteristic for the duration of the current terminal
   session for the user to whom the terminal is allocated. Therefore,
   if the terminal is not allocated, the /PERMANENT qualifier must be
   used with the SET TERMINAL command. You must have the LOG_IO or
   PHY_IO user privilege to use the /PERMANENT qualifier.

NOPERATOR

no operator coverage

   Facility: OPCOM, Operator Communication

   Explanation: A DCL command REQUEST specified a nonexistent
   operator. No terminals are currently enabled for that operator
   name.

   User Action: Reenter the DCL command REQUEST specifying an
   alternative operator.

NOPFNMAP

operation requires PFNMAP privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires PFNMAP privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you did not use a service or an argument for a particular service
   that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOPRED

logical predecessor not defined

   Facility: DEBUG, VMS Debugger

   Explanation: The logical predecessor of the identifier or
   instruction referenced is not defined. This message is
   informational.

   User Action: None.

NOPREV

no previous entry exists-new entry created for 'image'

   Facility: INSTALL, Install Utility

   Explanation: A Known File Entry is created via the REPLACE
   command, and there is no previous entry that had to be deleted
   first.

   User Action: None. The use of REPLACE implies that an old entry is
   expected to exist, but didn't.

NOPRINT

file 'filename' cannot be printed.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product installation required the printing of one
   or more files. The files could not be queued for printing.

   User Action: An undefined SYS$PRINT queue at your site probably
   caused this error. If you do not care that the files could not be
   printed, ignore this message. Otherwise, define a SYS$PRINT queue
   and reinstall the product.

NOPRIV

insufficient privilege or queue protection violation

   Facility: JBC, Job Controller

   Explanation: The queue protection denies access to the queue for
   the specified operation.

   User Action: None.

operation requires SYSPRV privilege

   Facility: CAF, Cluster Authorization File Service

   Explanation: Any access to the cluster authorization file requires
   SYSPRV privilege.

   User Action: Enter a SET PROFILE/PRIVILEGE=SYSPRV command, then
   reenter your original command.

no privilege for attempted operation

   Facility: SYSTEM, VMS System Services and JBC, Job Controllerand
   PTD, Pseudo Terminal

   Explanation: A command or program requested a system function
   that requires a specific user privilege or privileges; the current
   process does not have the requisite privilege or privileges.

   Or a program image attempted to access, modify, or delete a
   control area created and owned by a more privileged access mode;
   such areas include pages in memory, I/O channels, or timer queue
   entries.

   Or a command or program requested file or volume access which is
   denied.

   Or the requesting process does not have the privilege to read or
   write to this mailbox. (The protection mask is defined when the
   Mailbox is created.)

   User Action: If the message is in response to a command entered
   interactively, verify that the particular command, or qualifier,
   does not require a specific user privilege or privileges.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have. Or
   verify that you are not attempting to modify a VMS RMS or system-
   owned data area or memory page.

   If this message is associated with a vector disabled (VECDIS)
   status code, an ACL on the system's vector capability has
   prevented the process from executing vector instructions.

   In each case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

   Verify the file or volume name. Have the owner of the file or
   volume change the protection value.

user denied privilege to write to volume on 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: The user has requested initialization of a volume and
   does not have the privilege to write to it.

   User Action: Mount either a tape that the user has write privilege
   to or a blank tape. Request initialization of this tape when
   replying to the next mount request.




NOPRIVDIRSUM

some directories protected against access

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: During the directory scan the utility was prevented
   from reading a directory because of a privilege error (for
   example, the user running the utility lacked sufficient
   privileges). Since the utility's method of determining whether
   a file is lost is to scan all directories for the file, the
   utility's list of lost files is incorrect. Therefore, no attempt
   will be made to retrieve lost files.

   User Action: Assign yourself BYPASS privilege and rerun the
   utility.

NOPRMCEB

operation requires PRMCEB privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires PRMCEB privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOPRMGBL

operation requires PRMGBL privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires PRMGBL privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privilege function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOPRMMBX

operation requires PRMMBX privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires PRMMBX privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOPROC

the kit installation procedure is missing.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The main installation procedure for the product is
   not located on the distribution media.

   User Action: Contact your DIGITAL field service representative.

NOPROCESS

no subprocess to interact with

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The subprocess you tried to send data to or receive
   data from does not exist.

   User Action: Re-create the subprocess.

NOPRODS

None of the specified products were found.

   Facility: VMSINSTAL, Install Procedures

   Explanation: None of the products you specified for installation
   exist on the distribution media.

   User Action: Specify products that exist on the media.

NOPROT

protocol not supported on remote node

   Facility: REM, Set Host Facility

   Explanation: A DCL command SET HOST has been entered on a node
   that does not support the remote terminal protocol.

   User Action: None.

NOPSCTS

no psects defined in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The specified module did not define any psects. At
   least one psect must be defined in each object module.

   User Action: Define a psect in the specified module.

NOPSWAPM

operation requires PSWAPM privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires PSWAPM privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOQFILE

no disk quota file available

   Facility: SYSTEM, VMS System Services

   Explanation: The quota file does not exist.

   User Action: Verify that you are using the correct device. Create
   the quota file.

NOQUAL

no qualifier in statement 'number'

   Facility: FDL, Create/FDL Utility

   Explanation: You have left off a qualifier from the attribute
   keyword.

   User Action: Edit the FDL file and add the qualifier.

no qualifier in statement 'number'

   Facility: FDL, Edit/FDL Utility

   Explanation: You specified a secondary that requires a qualifier,
   but none is given.

   User Action: Specify a qualifier for a secondary.

qualifiers not allowed-supply only verb and parameters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command that has no qualifiers is specified with a
   qualifier.

   User Action: Reenter the command; do not specify any qualifiers.



NOQUECTX

no queue context

   Facility: JBC, Job Controller

   Explanation: A call was made to the $GETQUI system service
   requesting the $QUI_DISPLAY_JOB function without first
   establishing a queue context for this call.

   User Action: Modify the application to first
   establish a queue context by calling the $GETQUI
   system service in wildcard mode using the
   QUI$_DISPLAY_QUEUE function code.

NOQUESPACE

no space in system job queue file

   Facility: JBC, Job Controller

   Explanation: The system job queue file is full and cannot be
   extended.

   User Action: Notify the system manager, as this condition
   indicates a lack of space on the disk that contains the system job
   queue file. In the meantime, wait for existing jobs to complete
   and reenter your request.

NOQUEUE

'queue-name' queue does not exist

   Facility: Shared by several facilities

   Explanation: A request to enter or change a queued file failed
   because the queue does not exist.

   User Action: Verify the queue name in the command and reenter the
   command. To determine the names and status of currently available
   queues, use the DCL command SHOW QUEUE/DEVICES/BATCH.

   Note that the DCL commands SET QUEUE and SHOW QUEUE do not
   translate logical names. If you specified a logical name, reenter
   the command with the physical queue name.

NOQUOTE

quoted string missing end quote

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Your command line is missing a quotation mark (").

   User Action: Reenter the command line with both quotation marks.

NORCP

RCP not active

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NORCVBUF

NETACP-no receive buffer available

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOREAD

unable to access location

   Facility: SDA, System Dump Analyzer

   Explanation: SDA is unable to read a certain location. The
   inaccessible location may be an implied reference to memory made
   during the execution of an SDA command.

   User Action: None.

NOREADCP

no read access to interrupted command procedure

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An executing command procedure was interrupted by
   a CTRL-Y and is still active. The READ command is trying to read
   data from this interrupted command procedure which has no read
   access.

   User Action: To read data from the terminal, repeat the READ
   command using SYS$COMMAND as the input file. You can also use
   the STOP command to deactivate the interrupted command procedure,
   and repeat the READ command as originally specified.

NO_RECORD

unable to locate record for this transaction state

   Facility: LMCP, Log Manager Control Program

   Explanation: The transaction identifier's record could not
   be found when scanning for active transactions; however, the
   transaction is considered still active.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and include a BACKUP
   save set containing the output of the LMCP DUMP and the DCL DUMP
   commands for the given log file.

NOREDEFINE

built-in procedure 'procedure-name' cannot be redefined

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Your program uses a VAXTPU built-in procedure name as
   the name of a user-written procedure. Built-in procedures cannot
   be superseded by user-defined procedures.

   User Action: Give your procedure a name that does not conflict
   with any of the names of the VAXTPU built-in procedures.

NOREF

page reference not found

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: An internal error has occurred.

   User Action: Submit a Software Performance Report (SPR). If
   possible, include the file that caused the error in the Report
   (SPR).

NORELNOTE

unable to locate release notes

   Facility: VMSINSTAL, Install Procedures

   Explanation: You specified the Release Notes option during a
   layered product installation. The product does not include online
   release notes.

   User Action: None.

NORELOC

relocation of CASE instructions not supported

   Facility: PATCH, Patch Utility

   Explanation: The PATCH Utility does not automatically move CASE
   instructions to the patch area.

   User Action: CASE instructions may be moved to the patch area by
   using PATCH commands DELETE/INSTRUCTION and DEPOSIT/INSTRUCTION
   /PATCH_AREA and the MACRO assembler directive .WORD.

NOREMOTE

remote node name not permitted in 'string'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility found a network node name in a
   context where network access is not permitted.

   User Action: Reenter the command specifying a local device name,
   or log in to the desired node and reenter the EXCHANGE command on
   that node.

NORENDEV

cannot RENAME to a different device

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered a RENAME command
   which attempted to rename a file from one device to another.

   User Action: Use the COPY command to move a file to another
   device, or check the RENAME command for a misspelled device name.

NORENEXISTS

file 'filename' not renamed, 'filename' already exists

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility cannot rename a file because a
   file with the same name already exists.

   User Action: Choose a file name that does not already exist, or
   delete the existing file and redo the RENAME command.

NORENLOCK

file 'filename' not renamed, volume is write locked

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility could not perform a RENAME
   command because the output volume is write locked.

   User Action: Remount the output volume with write access, then
   reenter the command.

NOREPAIR

one or more volumes write locked-/REPAIR canceled

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that one or more volumes of
   the volume set are write locked, and therefore a /REPAIR operation
   cannot be executed.

   User Action: Write enable all volumes of the volume set and
   reenter the Verify Utility command line.

NOREQ

symbol 'symbol-name' not found in SDA symbol table

   Facility: SDA, System Dump Analyzer

   Explanation: SDA cannot find a symbol in the SYS.STB file that is
   vital to its initialization.

   User Action: None.

NOREQSYM

symbol 'name' not found in system symbol table

   Facility: SDA, System Dump Analyzer

   Explanation: SDA cannot find a symbol in the SYS.STB file that is
   required for proper initialization of SDA.

   User Action: Check the integrity of the symbol table file.

NORESTART

job is not restartable

   Facility: JBC, Job Controller

   Explanation: The specified job cannot be requeued because it is
   not defined to be restartable.

   User Action: None.

error 'status' attempting to restart server

   Facility: AUDSRV, Audit Server

   Explanation: The audit server process encountered an error when
   attempting to restart itself as a result of a previous error. The
   displayed status code reflects an error from the $CREPRC system
   service.

   User Action: Correct the indicated error and restart the audit
   server manually using the command SET AUDIT/SERVER=START.


NORETURNVALUE

built-in does not return a value

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This built-in does not return a value and cannot be
   used in situations in which a return value will be used.

   User Action: Do not use this built-in as part of an assignment
   statement or as part of an expression.

NORIGHTSDB

rights data base file not found

   Facility: AUTHORIZE, Authorize Utility and SYSTEM, VMS System
   Services

   Explanation: An attempt to access the rights database failed
   because the file does not exist or could not be found (if
   redirected with a logical name).

   User Action: Create a rights database using the AUTHORIZE command
   CREATE/RIGHTS, or contact the system manager to determine why the
   rights database file does not exist or is not available.

NORMAL

normal successful completion

   Facility: Shared by several facilities

   Explanation: This success message indicates that the operation
   completed normally. This is an informational message.

   User Action: None.

success

   Facility: LIBRAR, LIBRARY Command and LBR, Librarian Subroutine
   Package

   Explanation: This success message is associated with a code
   returned by the librarian, or generated by the DCL command
   LIBRARY. The operating system does not normally display this
   message. This is a success status code.

   User Action: None.


NORMAL_EXIT

normal exit-ppl index

   Facility: PPL, Parallel Processing Facility

   Explanation: This message indicates the occurrence of the normal
   participant termination event.

   User Action: Since the application requested this notification,
   response is application-dependent.

NOROOM

no room for new entry

   Facility: NCP, Network Control Program

   Explanation: Insufficient space for new table entry. For example,
   there is not enough paged pool to allocate room for a new node to
   be defined.

   User Action: Increase the resources DECnet is allocated.

no room in dictionary for definition

   Facility: DTK, DECtalk Facility

   Explanation: There is no room left in the dictionary for this
   definition.

   User Action: Correct your program so that it requests fewer
   dictionary entries or so that each entry is smaller.


NORSTBLD

cannot build symbol table

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger is unable to build a symbol table
   because of errors in the format of the image file.

   User Action: Relink the image and, if the error is reproducible,
   submit a Software Performance Report explaining how the image file
   is created.

cannot build symbol table

   Facility: PATCH, Patch Utility

   Explanation: When PATCH is initialized, it could not allocate
   space to build a symbol table.

   User Action: Check with your System Manager to ensure that the
   system is bootstrapped with enough virtual address space.


NORTTB

internal error-No routine table for object

   Facility: SMI, System Management Intergator/Server

   Explanation: An object is defined in server tables, but the entry
   point is 0.

   User Action: Submit a Software Performance Report showing all
   SYSMAN commands leading to this error.

NORUNMCR

account restricted - RUN and MCR commands not valid

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The RUN and MCR commands are foreign commands and
   have been disabled for this account. (See the VMS DCL Concepts
   Manual for an explanation of foreign commands.)

   User Action: This account requires that all images are run using
   verbs defined in the CLI table (called DCLTABLES) specified for
   this account.

NOSAVESET

Required save set 'letter' does not exist.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product save set with the specified letter,
   which is required for the installation, does not exist on the
   distribution media.

   User Action: Contact your DIGITAL field service representative.

NOSAVPEXC

no saved vector exception for the exception-id

   Facility: SYSTEM, VMS System Services

   Explanation: A call was made SYS$RESTORE_VP_EXCEPTION that
   specified a value for an exception ID that does not correspond
   to that of any saved vector exception state.

   User Action: Correct the program call so that it uses an exception
   ID that corresponds to one used by a previous call to SYS$SAVE_VP_
   EXCEPTION.

NOSCOPE

no scope exists to look up line 'line-number'

   Facility: DEBUG, VMS Debugger

   Explanation: The specified 'line-number' cannot be found because
   there is no current scope to look it up in.

   User Action: Specify the module explicitly and retry the
   operation.

NOSCS

error loading SCS code

   Facility: SYSGEN, System Generation Utility

   Explanation: You were unable to load SCSLOA.EXE.

   User Action: Do not attempt to load SCSLOA.EXE.

NOSECEX

no such section exists

   Facility: PPL, Parallel Processing Facility

   Explanation: The section specified to flush or delete does not
   exist.

   User Action: Recode your program to ensure that the section to
   flush or delete has been created.

NOSELECT

no select active

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You tried to select a range of text with only
   the built-in procedure SELECT_RANGE (and not with the built-in
   procedure SELECT as well).

   User Action: Begin a selection by using the built-in procedure
   SELECT.

NOSENDBUF

cannot SEND a buffer to a process using the buffer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You tried to send a buffer to a process using the
   buffer for its output. This can result in an infinite loop.

   User Action: Move or copy the data to a different buffer and send
   the new one.

NOSERVER

SMI Server not running in target node

   Facility: SMI, System Management Intergator/Server

   Explanation: Process SMISERVER is not running in the indicated
   node

   o  It may have been stopped with the STOP command.

   o  It may have been aborted.

   o  The remote system has not progressed far enough in the system
      startup procedure to have started SMISERVER.

   User Action: Determine why SMISERVER is not running. Restart it if
   necessary with the following command run from the SYSTEM account
   on the target system:

   $ @SYS$SYSTEM:STARTUP SMISERVER

NOSERVERS

No known servers

   Facility: LATCP, LAT Control Program

   Explanation: You entered a SHOW COUNTERS/SERVER or SHOW SERVERS
   command, but there are no servers in the LATCP database.

   User Action: None.

NOSETPRV

operation requires SETPRV privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires SETPRV privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privilege function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

You are not running on an account with SETPRV privilege.

   Facility: VMSINSTAL, Install Procedures

   Explanation: When VMSINSTAL begins an installation, it makes sure
   that your account has the SETPRV privilege. This check failed.

   User Action: You are asked if you want to continue the
   installation. DIGITAL recommends that you correct this situation
   before continuing.


NOSEVER

severity unspecified, ERROR used

   Facility: MESSAGE, Message Utility

   Explanation: The severity of a facility's messages has not been
   defined. The Message Utility has assigned the level ERROR to the
   messages.

   User Action: Add the appropriate severity levels to the message
   source file, either with severity definitions or with severity
   qualifiers on message definitions.

NOSHDWMEM

no eligible shadow set members to mount the shadow set

   Facility: MOUNT, Mount Utility

   Explanation: There are no valid volumes to create the shadow set.
   This error message is followed by the failed status code for each
   proposed member.

   User Action: Examine the status codes, correct the situation, and
   reenter the command.

NOSHMBLOCK

no free shared memory block available for creation

   Facility: SYSTEM, VMS System Services

   Explanation: No free shared memory control block (mailbox, common
   event flag cluster, or global section descriptor) is available for
   creation.

   User Action: Wait for the resource to become available, or reboot
   the system and reinitialize shared memory, specifying more of the
   needed resource.

NOSHMEM

operation requires SHMEM privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires SHMEM privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOSHMGSD

No shared memory global section dsc found for page

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOSHOWBUF

variable SHOW_BUFFER does not exist or is not a buffer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedure SHOW depends on SHOW_BUFFER
   existing as a variable that references a buffer.

   User Action: Create the variable SHOW_BUFFER and have it reference
   a buffer before retrying SHOW.

NOSHRD

file cannot be made SHARED

   Facility: INSTALL, Install Utility

   Explanation: Only native-mode images and compatibility-mode
   images supported by the AME provided by VAX RSX are supported
   as shareable known files.

   User Action: Reinstall without the /SHAR qualifier.

NOSHRIMG

image activator message

   Facility: SYSTEM, VMS System Services

   Explanation: Privileged shareable images, also known as user-
   written system services or protected images, cannot reference
   other shareable images. This check is made when the privileged
   shareable image is activated. If a reference to another image is
   detected, the entire activation is aborted and this error message
   is issued.

   User Action: Rewrite the privileged shareable image so that it
   does not reference other shareable images.

NOSIGNAL

no signal currently active

   Facility: SYSTEM, VMS System Services

   Explanation: A call to the Unwind Call Stack ($UNWIND) system
   service is made when there is no exception condition. The
   procedure that is calling $UNWIND is not called by the exception
   dispatcher.

   User Action: Check for a programming error.

NOSLOT

no pcb available

   Facility: SYSTEM, VMS System Services

   Explanation: The maximum number of processes that can be created
   at one time has been exceeded.

   User Action: Wait for another process to be deleted, or increase
   the MAXPROCESSCNT system parameter.

NOSOLICIT

interrupt message not solicited

   Facility: SYSTEM, VMS System Services

   Explanation: The program attempted to send an interrupt message to
   a partner on a remote node, but the DECnet-VAX implementation on
   that node has not solicited a message.

   User Action: Wait and retry the request.

NOSPACE

failure to map symbol table, EXPREG status = 'xxxxxxxx'

   Facility: TRACE, Traceback Facility

   Explanation: The traceback facility cannot perform a symbolic
   traceback because the symbol table cannot be mapped. The
   hexadecimal status code from the Expand Program/Control Region
   ($EXPREG) system service indicates the reason for the failure.

   User Action: Submit a Software Performance Report (SPR).

There are not enough blocks to restore the system disk.

   Facility: VMSINSTAL, Install Procedures

   Explanation: After installation on a dual-RL02 system, VMSINSTAL
   attempts to restore your system disk to its original tailoring
   configuration. However, there are not enough free blocks left on
   the system disk.

   User Action: VMSINSTAL tells you how many additional free blocks
   are required. Do the following:

   1. Purge and delete files to make more space on the system disk.

   2. Restore the original tailoring configuration.


NOSRCHSTR

search string not set

   Facility: DEBUG, VMS Debugger

   Explanation: No current search string is defined for the DEBUG
   command SEARCH. The SEARCH command is entered without a search
   string, indicating that the current search string should be
   used. But no previous SEARCH command has been entered to define a
   current search string.

   User Action: Explicitly specify the desired search string on the
   command.

NOSRCLIN

no source line for address 'address_value'

   Facility: DEBUG, VMS Debugger

   Explanation: No source line corresponds to the address 'address_
   value' specified with the EXAMINE/SOURCE command. This message is
   informational.

   User Action: None.

NOSTATS

run-time statistics not available

   Facility: ERF, Error Log Utility

   Explanation: An internal consistency error was encountered.

   User Action: Submit a Software Performance Report (SPR).

NOSTRING

no search string specified

   Facility: SEARCH, SEARCH Command

   Explanation: You did not specify a search string.

   User Action: Specify a search string.

NOSTRMEM

string allocation failure

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

NOSUBEXI

a subprocess does not exist for this virtual display

   Facility: SMG, Screen Management Facility

   Explanation: A subprocess does not exist for the specified virtual
   display.

   User Action: Call SMG$CREATE_SUBPROCESS to create a subprocess for
   this virtual display.

NOSUCC

logical successor not defined

   Facility: DEBUG, VMS Debugger

   Explanation: The logical successor of the referenced instruction
   or identifier is not defined.

   User Action: None.

NOSUCHACE

ACE for object 'filename' does not exist

   Facility: SET, SET Facility

   Explanation: The specified ACE to be deleted or replaced does not
   exist.

   User Action: Verify the existence of the ACEs being replaced
   or deleted with the DIRECTORY/ACL command or the DCL SHOW ACL
   command.

NOSUCHBPT

no such breakpoint

   Facility: DEBUG, VMS Debugger

   Explanation: The CANCEL BREAK command specified an address that is
   not the address of a breakpoint.

   User Action: Use the SHOW BREAK command to find the location of
   the current breakpoints, and then cancel any of these breakpoints
   that you want to cancel.

NOSUCHCHAR

no such characteristic

   Facility: JBC, Job Controller

   Explanation: The specified characteristic does not exist. In a
   wildcard $GETQUI operation, no more characteristics matching the
   specified selector exist.

   User Action: None.

NOSUCHCPU

CPU does not exist, system is not a multiprocessor, or
multiprocessing disabled

   Facility: SMP, Symmetric Multiprocessing

   Explanation: This message is output by the $START/CPU, $STOP/CPU,
   or $SHOW CPU command in one of the following cases:

      Case 1: A $START/CPU, $STOP/CPU, or $SHOW CPU command was
      entered which specified one or more CPU IDs not present in
      the configuration.
      Case 2: The command was entered on a single CPU configuration
      or on a CPU type that does not support multiprocessing
      operation.
      Case 3: A $START/CPU or $STOP/CPU command was entered on a
      multiprocessor configuration in which multiprocessing has been
      disabled through the MULTIPROCESSING SYSGEN parameter.

   Explanation: The action to take for each case follows:

      Case 1: Enter the $SHOW CPU command to determine what CPU
      IDs are present in the configuration, and reenter the failed
      command specifying the correct CPUs and omitting the CPUs not
      present.
      Case 2: None. This command is not useful on such CPUs.
      Case 3: Reset this parameter and reboot the system to enable
      multiprocessor operation.

NOSUCHCTX

context parameter invalid or no previous SMI$INIT

   Facility: SMI, System Management Intergator/Server

   Explanation: This message indicates an internal error. SMI call
   specifies an invalid context handle.

   User Action: Submit a Software Performance Report showing the
   SYSMAN commands leading to the error.

NOSUCHDEV

nonexistent drive

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: A nonexistent drive was specified for the satellite
   system disk.

   User Action: Check the load assist parameter specification in
   the DECnet MOP database using NCP. Ensure that the correct system
   disk is specified and make sure it is served using the SHOW DEVICE
   /SERVED command.

no such device available

   Facility: SYSTEM, VMS System Services

   Explanation: A device name specified for a command or program does
   not exist, or a system volume is not ready and available for use.

   User Action: Verify that the device name is specified correctly,
   and that the device is available in your system configuration. Use
   the DCL command SHOW DEVICES to determine whether such a device
   exists.

   If the device is coded as a logical name, verify that it is
   assigned a valid equivalence name.


NOSUCHELE

no element with the specified ID exists

   Facility: PPL, Parallel Processing Facility

   Explanation: No element is specified by the input identification.

   User Action: Recode your program to ensure that the input
   identification is for a created element.

NOSUCHENT

no such entry

   Facility: JBC, Job Controller

   Explanation: The specified job entry in the system queue file does
   not exist.

   User Action: None.

NOSUCHFILE

no such file

   Facility: SYSTEM, VMS System Services

   Explanation: The message indicates that no file with the given
   file specification identifier exists, or that the directory entry
   points to a file that is deleted.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

no such file

   Facility: JBC, Job Controller

   Explanation: The specified file does not exist. In a wildcard
   $GETQUI operation, no more files matching the specified selector
   exist.

   User Action: None.

startup file does not exist

   Facility: START, System Startup Driver

   Explanation: A startup component file specified in the startup
   database does not exist during system startup.

   User Action: Verify that the entry in the startup database is
   correct. If it is correct, verify that the component file is
   located in the SYS$STARTUP directory.



NOSUCHFORM

no such form

   Facility: JBC, Job Controller

   Explanation: The specified form does not exist. In a wildcard
   $GETQUI operation, no more forms matching the specified selector
   exist.

   User Action: None.

NOSUCHJOB

no such job

   Facility: JBC, Job Controller

   Explanation: The specified job does not exist. In a wildcard
   $GETQUI operation, no more jobs matching the specified selector
   exist.

   User Action: None.

NOSUCHLOC

no lock with the specified ID exists

   Facility: PPL, Parallel Processing Facility

   Explanation: No lock element is specified by the input
   identification.

   User Action: Recode your program to ensure that the input
   identification is for a created lock element.

NOSUCHMEM

no shared memory found at specified NEXUS

   Facility: SYSGEN, System Generation Utility

   Explanation: The desired shared memory unit number is not found in
   a search of the backplane interconnect adapter list.

   User Action: Reenter the command with the correct device unit
   number.

NOSUCHMOD

module 'module-name' not found in library 'library-name'

   Facility: LINK, Linker Utility

   Explanation: A module requested from a library with the /INCLUDE
   qualifier could not be found.

   User Action: Correct the command line and relink.

NOSUCHMODU

module 'path-name' is not in module chain

   Facility: DEBUG, VMS Debugger

   Explanation: The module 'path-name', specified in the SET MODULE
   command, does not exist in the image. This message can be caused
   when: (1) a module name has been entered incorrectly or (2) a
   module is compiled with the /NOTRACE switch.

   User Action: Specify a module that is in the image.

no such module name 'module-name'

   Facility: PATCH, Patch Utility

   Explanation: The specified module name is not contained in the
   image file.

   User Action: Retry the operation specifying a module name that is
   contained in the image file.


NOSUCHNAM

no element with the specified name exists

   Facility: PPL, Parallel Processing Facility

   Explanation: The name you input does not specify an existing
   element.

   User Action: Recode your program to ensure that the name matches a
   created element.

NOSUCHNODE

no such node while stopping queue 'queue-name' continuing to stop
other queues

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: This error occurred during a $SNDJBC system service
   call attempting to reset the queue. The specified queue is on a
   node other than the node on which the upgrade procedure is being
   executed.

   User Action: Be aware that queue is in an inconsistent state.

remote node is unknown or not reachable

   Facility: JBC, Job Controller

   Explanation: A DCL command such as START/QUEUE was executed, or
   a call to the $SNDJBC system service was made that requires the
   job controller on one node of a cluster to communicate with the
   job controller on another node to perform the requested operation.
   This condition indicates that the remote job controller could not
   be reached because an invalid node name was specified, the remote
   node is not reachable, or the job controller on the remote node is
   not running.

   User Action: Check the node name specified and verify that the
   remote node is currently in the cluster, then retry the operation.

remote node 'node-name' not known or unavailable.

   Facility: VMSINSTAL, Install Procedures

   Explanation: You are trying to install a product on a remote node
   that is either unknown or unavailable.

   User Action: Specify an existing node name or try the installation
   again when the node becomes available.

specified node does not exist

   Facility: SYSTEM, VMS System Services

   Explanation: The node name portion of a file or task specification
   refers to a node that is unknown to the network ACP.

   User Action: Check the node name specification. Verify the status
   of the network and available nodes with the DCL command SHOW
   NETWORK.




NOSUCHOBJ

network object is unknown at remote node

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt is made to initiate a DECnet-VAX logical
   link connection. The target object of the connect could not be
   found on the specified node. The object name or object number is
   unknown, or the command file used to start the object could not be
   found.

   User Action: Notify the system manager of the remote node. Refer
   to the VMS Networking Manual for additional information.

NOSUCHPART

specified participant not found

   Facility: SYSTEM, VMS System Services

   Explanation: The participant identifier specified was not found.
   This is an error in the resource manager.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and include a BACKUP
   save set containing the output of the LMCP DUMP and the DCL DUMP
   commands for the given log file.

NO_SUCH_PARTY

no such party in this application

   Facility: PPL, Parallel Processing Facility

   Explanation: The specified participant does not exist in this
   application.

   User Action: Recode your program to ensure that the correct
   participant is specified in the call to this routine.

NOSUCHQUE

no such queue

   Facility: JBC, Job Controller

   Explanation: The specified queue does not exist. In a wildcard
   $GETQUI operation, no more queues matching the specified selector
   exist.

   User Action: None.

NOSUCHRM

specified resource manager not found

   Facility: SYSTEM, VMS System Services

   Explanation: The resource manager identifier specified was not
   found. This is an error in the resource manager.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and include a BACKUP
   save set containing the output of the LMCP DUMP and the DCL DUMP
   commands for the given log file.

NOSUCHRQST

no such request

   Facility: OPCOM, Operator Communication

   Explanation: A DCL command REPLY specified a nonexistent message
   identification number.

   User Action: Verify the message identification number displayed in
   the message; reenter the command with the correct message number.
   If the request is canceled by the user who issued it, no action is
   necessary.

NOSUCHRTN

unknown CLI routine 'routine-name'

   Facility: CDU, Command Definition Utility

   Explanation: You specified a routine name instead of an object
   module in your CLD file when generating CLI tables.

   User Action: Remove the routine name from the CLD file.

NOSUCHRVN

the /VOLUME = 'number' qualifier is invalid, volume set
   contains 'number' volumes

   Facility: BACKUP, Backup Utility

   Explanation: The value specified for the /VOLUME qualifier is
   larger than the number of volumes in the volume set.

   User Action: Reenter the command using a smaller value.

NOSUCHSEC

no such (global) section

   Facility: SYSTEM, VMS System Services

   Explanation: The global section name specified in a request to map
   a global section does not exist.

   User Action: Check for a programming error. Verify that the
   program that creates the global section successfully created the
   section, and that the section has not been deleted. Also, check
   that the logical name strings specifying the global section name
   match.

NOSUCHSERV

service name does not exist

   Facility: LATCP, LAT Control Program

   Explanation: You attempted to use the SET command to modify a
   service not previously set up with a CREATE command.

   User Action: Use the SHOW CHARACTERISTICS command to look at the
   services defined for your node. Use the CREATE SERVICE command to
   create the service (up to 8 allowed) for your node. Reenter the
   command.

NOSUCHSYM

no such symbol

   Facility: LIB, Library Facility

   Explanation: You specified an undefined symbol.

   User Action: Retry the operation specifying a defined symbol.

no such symbol

   Facility: PATCH, Patch Utility

   Explanation: A symbol is specified that is not contained in the
   PATCH symbol table.

   User Action: Use the PATCH Utility command SET MODULE to bring
   local symbols into the PATCH symbol table.


NOSUCHTID

specified transaction not found

   Facility: SYSTEM, VMS System Services

   Explanation: The transaction identifier (TID) specified in the
   user program was not found.

   User Action: Check the user program and correct the error.

NOSUCHTPT

no such tracepoint

   Facility: DEBUG, VMS Debugger

   Explanation: The CANCEL TRACE command specified an address that is
   not the address of a tracepoint.

   User Action: Use the SHOW TRACE command to display the current
   tracepoints and then cancel any that you want to cancel.

NOSUCHUSER

login information not recognized at remote node

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt is made to initiate a DECnet-VAX logical
   link connection. The supplied access control string is not
   recognized at the remote node. In particular, the username,
   password, or account field is not recognized.

   User Action: The access control string specified is incorrect.
   If default access control is specified, notify the system manager
   that the DECnet configuration database needs to be updated.

   This error can be returned if the specified access control string
   is not recognized (for example, no record in the UAF), is too
   long, or contained illegal characters.

   Refer to the VMS Networking Manual for additional information.

user 'username' not currently logged in

   Facility: SHOW, SHOW Command

   Explanation: When using the SHOW USER command, you specified a
   user who is not currently logged in.

   User Action: None.


NOSUCHUSR

no such user 'username'

   Facility: MAIL, Mail Utility

   Explanation: You attempted to send a message to a user that does
   not exist as an authorized user of the computer system. If you
   attempted to send the message to mutiple users and at least one
   is authorized, this message appears for each unauthorized user,
   followed by the question: "Do you want to send it anyway (Y/N)?"

   User Action: Reenter the command and specify a valid username. If
   you are asked if you want to send the message anyway, respond Y
   (yes) or N (no).

NOSUCHVERB

the CLI table does not contain verb name 'verb-name'

   Facility: CDU, Command Definition Utility

   Explanation: The verb you tried to delete is not defined in the
   current CLI table.

   User Action: Make sure that the syntax is correct and try to
   delete the verb again.

NOSUCHWPT

no such watchpoint

   Facility: DEBUG, VMS Debugger

   Explanation: The CANCEL WATCH command specified an address that is
   not the address of a watchpoint.

   User Action: Use the SHOW WATCH command to display the current
   watchpoints and then cancel any that you want to cancel.

NOSUMM

an input file may be specified only when /SUMMARY is present

   Facility: MONITOR, Monitor Utility

   Explanation: A list of files is specified on the /INPUT qualifier,
   indicating a multifile summary request, but the /NOSUMMARY
   qualifier is also present, explicitly or implicitly. A list of
   files may be specified only for a multifile summary request.

   User Action: If a multifile summary is desired, reenter the
   MONITOR request, specifying the /SUMMARY qualifier. If a multifile
   summary is not desired, reenter the MONITOR request specifying the
   /INPUT qualifier with a single file.

NOSYMBOL

symbol 'xxx' is not in the symbol table

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: The symbol 'xxx' cannot be located in the utility's
   symbol table. This can be caused when the module that defines the
   symbol has not been added to the utility's symbol table, or when a
   symbol name that is not in the image has been entered.

   User Action: Add the required module to the utility's symbol table
   with the SET MODULE command or specify the correct symbol name.

NOSYMBOLS

no 'block-type' symbols found to format this block

   Facility: SDA, System Dump Analyzer

   Explanation: SDA cannot locate the symbols needed to format a
   block as a particular block type.

   User Action: Use the SDA command READ to include the specific
   block type symbols in the SDA symbol table.

no global symbol table found in 'image-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: There is no symbol table in the shareable image.

   User Action: The linker always produces a symbol table, even if
   it is empty. If this error persists after relinking, submit a
   Software Performance Report with the relevant files.


NOSYSACT

no action on .SYS files

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility did not perform the requested
   action on files with the file type SYS.

   User Action: Normally no action is required, since SYS files get
   special treatment. If it is desired to modify SYS files, reenter
   the command with the /SYSTEM qualifier.

NOSYSDISK

no access to system disk

   Facility: BACKUP, Backup Utility

   Explanation: The system disk is not accessible.

   User Action: Determine why the system disk is inaccessible. If
   possible, make the system disk operational and retry the BACKUP
   command.

NOSYSGBL

operation requires SYSGBL privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires SYSGBL privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOSYSLCK

operation requires SYSLCK privilege

   Facility: SYSTEM, VMS System Services

   Explanation: You tried to lock a systemwide resource when you did
   not have SYSLCK privilege.

   User Action: Ask the system manager for SYSLCK privilege; or
   remove the LCK$M_SYSTEM flag.

NOSYSNAM

operation requires SYSNAM privilege

   Facility: SYSTEM, VMS System Services and JBC, Job Controller

   Explanation: A command or program requested a system function that
   requires SYSNAM privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privilege function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOSYSPRV

operation requires SYSPRV privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires SYSPRV privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privilege function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

Not enough SPTEs to take selective system dump - switching to complete memory dump

   Facility: BUGCHECK, System Bugcheck

   Explanation: When writing a selective dump (SYSGEN parameter
   DUMPSTYLE set to 1), the VMS operating system needs to remap
   portions of memory for easy access and for efficient writing of
   the dump file. The VMS operating system requests 127 System Page
   Table Entries (SPTEs) during the bootstrap sequence so that the
   SPTEs are ready when needed. If the system is configured so that
   there are not sufficient SPTEs to create a selective dump, the
   system attempts to write a complete dump.

   User Action: When the system comes back up, run AUTOGEN and reboot
   with a larger SYSGEN parameter SPTREQ.

NOT1STVOL

'save-set-spec' is not the start of a save set

   Facility: BACKUP, Backup Utility

   Explanation: The volume mounted as the first volume of the
   specified save set is a continuation volume. This is valid if
   the operation is not a restore with the /IMAGE qualifier.

   User Action: Reevaluate the operation to ensure that the correct
   results are obtained.

tape 'tape-name' is not the start of a save set

   Facility: BACKUP, Backup Utility

   Explanation: A restore or compare operation did not begin with the
   first volume in the save set.

   User Action: None. The Backup Utility allows you to begin restore
   and compare operations without mounting the first volume.


NOTACLU

'device-name' is not a cluster-wide device

   Facility: MOUNT, Mount Utility

   Explanation: An attempt was made to mount a device on all nodes
   in the cluster by specifying the /CLUSTER qualifier, however, the
   device specified is not available, nor can it be made available,
   cluster-wide.

   User Action: Reenter the command without the /CLUSTER qualifier.

NOTALLPRIV

not all requested privileges authorized

   Facility: SYSTEM, VMS System Services

   Explanation: You requested unauthorized privileges from $SETPRV.
   Only authorized privileges will be granted.

   User Action: If necessary, ask the system manager to grant you the
   appropriate privileges.

NOTALLSYM

unable to initialize symbols for default modules

   Facility: PATCH, Patch Utility

   Explanation: The PATCH symbol table did not have enough room to
   include symbols for all the modules normally inserted into the
   table upon execution of PATCH.

   User Action: To make room for the new modules, enter the PATCH
   command SHOW MODULE to determine which modules are in the symbol
   table, then enter the PATCH command CANCEL MODULE specifying the
   module names whose symbols are no longer required. Then reenter
   the PATCH command SET MODULE.

NOTANSI

not ANSI volume on 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: The volume on the specified device is not an ANSI-
   formatted magnetic tape.

   User Action: Initialize the tape and reenter the mount request or
   mount the tape foreign.

tape is not valid ANSI format

   Facility: BACKUP, Backup Utility

   Explanation: The volume does not have ANSI standard labels.

   User Action: Locate and mount the correct volume.


NOTAPEOP

no tape operator

   Facility: SYSTEM, VMS System Services

   Explanation: An operation failed because no system operator is
   available to satisfy a requirement for manual assistance; for
   example, to mount the next volume in a multivolume tape file.

   User Action: Ensure that the tapes were mounted on the original
   mount request or run the job when an operator is present.

NOTARRAY

indexed variable is not an array

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The variable being indexed is not an array.

   User Action: Use indexing with array variables only.

type of variable is not array

   Facility: DEBUG, VMS Debugger

   Explanation: The variable being treated as an array has not been
   defined as one.

   User Action: Check that the correct variable reference is being
   made.


NOTASCII

parameter 'name' is not ASCII type

   Facility: SYSBOOT, System Bootstrap Facility and SYSGEN, System
   Generation Utility

   Explanation: An ASCII value is specified in a SET command for a
   non-ASCII parameter.

   User Action: Reenter the command specifying a correct parameter
   value.

NOTASSIGN

queue not assigned

   Facility: JBC, Job Controller

   Explanation: The specified queue cannot be deassigned because it
   is not assigned.

   User Action: None.

NOTASTRUCT

'symbol-name' was not declared as a structure

   Facility: DEBUG, VMS Debugger

   Explanation: A VAX BLISS-32 structure reference specified a symbol
   'symbol-name' that was not declared a structure.

   User Action: Reenter the command with a valid symbol reference.

NOT_A_TERM

pasteboard attached to a device that is not a terminal

   Facility: SMG, Screen Management Facility

   Explanation: This is an informational message stating that the
   pasteboard has been created, but that the output device is not a
   terminal.

   User Action: None.

NOT_A_TRM

device is not a terminal

   Facility: DTK, DECtalk Facility

   Explanation: This is an informational message telling you that the
   output device is not a terminal.

   User Action: None.

NOT_AVAILABLE

requested resource not available now

   Facility: PPL, Parallel Processing Facility

   Explanation: Success status returned when the user requests
   immediate nonblocking access to a resource that is not available.

   User Action: Continue normally.

NOTBKBLOCK

invalid subsystem code in save set

   Facility: BACKUP, Backup Utility

   Explanation: An incorrect value occurred in the subsystem code
   field of a save set block. Data in the save set is corrupted. The
   save set data is lost.

   User Action: None.

NOTBOOCAP

not a Boolean capability

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler expected a Boolean capability
   name but encountered something else.

   User Action: Check your terminal definiton. Perhaps you misspelled
   the Boolean capability name or omitted another statement
   such as STRING or NUMERIC which would have terminated Boolean
   capabilities.

NOTCLASS

'device-name' not a 'type' device, type is 'type'

   Facility: SHOW, SHOW Command

   Explanation: The specified device is not the type of device that
   you specified in the command line.

   User Action: None.

NOTCMPLT

'input-filespec' not completely copied

   Facility: Shared by several facilities

   Explanation: A copy operation began but did not finish. This
   message is accompanied by a VMS RMS message indicating the reason
   for the failure.

   User Action: Take corrective action based on the accompanying
   message. Use the DCL command TYPE or DUMP to verify the contents
   of the output file, and delete the output file before reentering
   the command.

NOTCOM

BATCH mode can only be used for .COM files

   Facility: START, System Startup Driver

   Explanation: An entry in the STARTUP component file specifies a
   component file to be run with the BATCH command whose file type is
   not COM.

   User Action: Use the STARTUP MODIFY FILE command at the SYSMAN>
   prompt to correct either the file name or the execution mode.

NOTCOPIED

'input-filespec' not copied

   Facility: Shared by several facilities

   Explanation: A requested input file could not be copied. This
   message is usually accompanied by a VMS RMS message indicating the
   reason for the failure.

   User Action: Take corrective action based on the accompanying
   message.

file 'filename' not copied to 'filespec'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility did not copy a file.

   User Action: This message will be followed by a message describing
   the actual reason the copy could not be done. Take corrective
   action based on the following message.


NOTCOP_RETRY

error copying 'filename', will retry

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an error while
   copying the file, but after taking corrective action EXCHANGE
   will retry the copy.

   User Action: This is most likely due to EXCHANGE discovering a bad
   block on a volume, and EXCHANGE will try again to copy the file to
   a good space on the volume.

NOTCREATOR

request denied, user is not on creator port

   Facility: SYSTEM, VMS System Services

   Explanation: A shared memory global section may be deleted or
   updated only by a process running on the same processor as the
   creator of the section. If the processor becomes inoperative, no
   one owns the section.

   User Action: Enter the request from the creator's processor.
   After a processor becomes inoperative, it will be necessary to
   reboot and reinitialize the shared memory in order to delete those
   sections without owners.

NOTCTX

symbol specified is not a valid context symbol

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You are trying to use a symbol that has a type other
   than a context type such as PROCESS_CONTEXT.

   User Action: Refer to the documentation of the lexical function
   you are trying to use for more information.

NOTCURPC

target of EXAMINE/OPERANDS is not the current PC results may be
unexpected

   Facility: DEBUG, VMS Debugger

   Explanation: The operands being examined will probably give
   incorrect results, most likely because the context for the
   instruction is not set up properly. Specifically, the values of
   registers used in address computations depend on the previous
   series of instructions being executed, which is not done in this
   case.

   User Action: Only use EXAMINE/OPERANDS with .0\%PC.

NOTDDBDDB

corrupted DDB list

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTDECSTRG

illegal character in decimal string

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A decimal string contained a character other than the
   digits 0 through 9 and a leading plus or minus sign.

   User Action: Correct the syntax of the decimal string.

NOTDEFINABLE

that key is not definable

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The key that you tried to define using the built-in
   procedure DEFINE_KEY is not a definable key.

   User Action: Use a definable key as outlined in the description
   of the DEFINE_KEY built-in procedure in the VAX Text Processing
   Utility Manual.

NOTDELETED

file 'filename' not deleted

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility did not delete the specified
   file.

   User Action: This message will be followed by another message
   giving the reason why the file could not be deleted. Take
   corrective action based on the second message.

purging a record not marked as deleted

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).


NOTDIR

file is not a directory

   Facility: SET, SET Facility

   Explanation: The specified file is not a directory file.

   User Action: Reenter specifying an existing directory file.

NOTDISCON

terminal is not disconnectable-explicitly specify LOGOUT

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An attempt has been made to disconnect a terminal
   that has not been set as disconnectable from the current process.
   A disconnect under these circumstances would log out the user and,
   therefore, is not permitted.

   User Action: Either explicitly log out or set the terminal as
   disconnectable by using the SET TERMINAL/PERMANENT/DISCONNECT
   command and try again.

NOTDISK

device must be a Files-11 format disk

   Facility: SET, SET Facility

   Explanation: The operation that you are trying to perform requires
   a Files-11 format disk. The device that is specified does not meet
   these requirements. For example, this message is produced when you
   enter the SET VOLUME command to a tape or terminal. The SET VOLUME
   command only accepts Files-11 devices.

   User Action: Make sure that the device meets the requirements of a
   Files-11 format disk before performing the operation.

NOTDONE

'feature-name' not yet a supported feature

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: The feature you attempted to use is recognized but
   not implemented by PATCH. The name of the feature is indicated
   in the error message. Or the DEBUG command DEPOSIT specified an
   instruction with a literal that the debugger does not support at
   this time.

   User Action: None.

command not complete

   Facility: NCP, Network Control Program

   Explanation: Not enough command information has been supplied
   to determine the intent of the command. Prompting does not occur
   because the command is included in a command procedure.

   User Action: Modify the command in the command procedure to make
   it a valid command.


NOTENABOPT

not a legal ENABLE option

   Facility: MACRO, VAX MACRO Assembler

   Explanation: An argument to an .ENABLE or .DISABLE directive is
   not a legal option.

   User Action: Delete the option or replace it with a legal option.

NOTENUFOPR

not enough operands supplied

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The instruction requires more operands than were
   specified in the statement.

   User Action: Either add the operands or change the instruction.

NOTERM

command device is not a terminal

   Facility: REM, Set Host Facility

   Explanation: SET HOST is invoked from a batch job. (SYS$COMMAND
   is not a terminal.) You can invoke SET HOST only from interactive
   terminal sessions.

   User Action: None.

NOTERMS

no such terminal

   Facility: LATCP, LAT Control Program

   Explanation: A nonexistent port is specified in a SHOW command.

   User Action: Ensure that the port exists and reenter the command.
   Use the SHOW PORTS command to look at the ports for your service
   node.

NOTERRORKEYWORD

error handler selector is not an error keyword

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The specified error handler selector is not an error
   keyword.

   User Action: Specify only error keywords as error selectors.

NOTFCBFCB

FCB linkage broken

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTFCBWCB

Bad FCB pointer in window

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTFCPWCB

Not FCP window in IRP

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTFILEDEV

device is not file structured

   Facility: Shared by several facilities

   Explanation: A file specification containing a directory, or file
   name and/or file type is used for an I/O operation for a device
   that does not support random access, for example, a line printer.

   User Action: Verify the device name and the file specification; if
   a logical name is specified, ensure that the correct equivalence
   name is assigned. Correct the source program or reenter the
   command, as applicable.

NOTFOU

not found

   Facility: LIB, Library Facility

   Explanation: LIB$FIND_VM_ZONE could not locate another VM zone.
   This message is a success status.

   User Action: None.

NOTFOUND

specified entry not found

   Facility: ERF, Error Log Utility

   Explanation: No entries matching the specified selection criteria
   were found.

   User Action: None.

no messages containing 'text' found

   Facility: MAIL, Mail Utility

   Explanation: You entered a DCL command SEARCH specifying text to
   be found in a message. This text is not found.

   User Action: Attempt to search for different text.


NOTFR

no transfer address

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The image file does not have a transfer address.

   User Action: Check that the source program has specified a
   transfer address and, if necessary, reassemble and relink the
   program.

NOTFROMLAT

Unable to shut down LAT from a LAT terminal

   Facility: LATCP, LAT Control Program

   Explanation: You entered a LATCP STOP NODE command from a LAT
   terminal.

   Explanation: Reenter the command from a console on your service
   node.

NOTGENDEV

not a generic device

   Facility: MOUNT, Mount Utility

   Explanation: You specified an invalid generic device.

   User Action: Retry the operation specifying a valid generic
   device.

NOTHEN

IF or ON statement syntax error-check placement of THEN keyword

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The syntax of an IF or an ON statement is incorrect.

   User Action: Correct the syntax of the statement by including the
   THEN statement in the proper place.

NOTHLPLIB

not a HELP library

   Facility: LBR, Librarian Subroutine Package

   Explanation: The library specified in LBR$GET_HELP is not a help
   library.

   User Action: Determine that the library is a help library before
   calling the routine; specify the correct library name.

NOTIDFMT

ID name parameter does not translate to ID format

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The identifier name that you specified does not
   translate to a corresponding value in general identifier format.
   Identifier name values translate to either general identifier
   format or UIC format. General identifier names may be 1 through
   31 alphanumeric characters and are stored with an integer value
   in the range of 32,768 to 268,435,455. General identifiers are
   created by the AUTHORIZE command ADD/IDENTIFIER.

   When you use the AUTHORIZE command GRANT/IDENTIFIER, the first
   identifier you specify must be in general identifier format. In
   other words, you cannot grant a UIC-format identifier to another
   UIC-format identifier.

   User Action: Determine why the identifier name is not a general
   ID. You can display an identifier name and its corresponding value
   with the AUTHORIZE command SHOW/IDENTIFIER. To change the value of
   an identifier name, use the AUTHORIZE command MODIFY/IDENTIFIER.

NOTIDX

output file is not an indexed file

   Facility: CONVERT, Convert Utility and CONVERT, Convert/Reclaim
   Utility

   Explanation: You specified the /MERGE qualifier and the output
   file is not an indexed file.

   User Action: Specify /NOMERGE and try again.

NOTIFY

the /NOTIFY qualifer is not allowed-do not use with /WAIT or in batch jobs

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: /NOTIFY should only be used when you specify the
   /WAIT qualifier and when the SPAWN command is executed from within
   a noninteractive process.

   User Action: Do not use /NOTIFY.

NOTIMGLIB

file 'filename' is not a shareable image symbol table library

   Facility: LINK, Linker Utility

   Explanation: The system library IMAGELIB is found, but is not a
   shareable image library.

   User Action: Correct the file name and relink.

NOTIMP

not implemented

   Facility: Shared by several facilities

   Explanation: You tried to use a call, routine, or feature that is
   not implemented in this version.

   User Action: Use a higher version of the routine or feature, or
   code your program to eliminate this call.

NOT_IMPL

function not implemented for this object

   Facility: SMI, System Management Intergator/Server

   Explanation: Internal error. The function you requested of an SMI
   object is not defined.

   User Action: Submit a Software Performance Report showing the
   exact sequence of SYSMAN commands leading to the error.

NOTIMPLAN

'expression-type' is not implemented at command level

   Facility: DEBUG, VMS Debugger

   Explanation: The 'expression-type' is not supported at this type.

   User Action: Specify a type of expression that the debugger
   supports.

NOTIMPLEMENTED

built-in compiled by 'name' is not implemented by 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The section file contains a reference to a built-in
   procedure implemented in another version of VAXTPU, but which is
   not implemented in this version of VAXTPU.

   User Action: You must use the version of VAXTPU that compiled the
   section file.

NOTIMPOPCODE

opcode in delayed work queue not implemented

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

NOTINANIF

statement outside condition body

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A .IF_FALSE, .IF_TRUE, .IF_TRUE_FALSE, .IFF, .IFT, or
   .IFTF subconditional directive is not in a conditional assembly
   block.

   User Action: Replace the subconditional directive with a
   conditional directive or delete the subconditional directive.

NOTINITED

LAT terminal port driver controller init not called

   Facility: LATCP, LAT Control Program

   Explanation: The LAT port driver cannot start because it is not
   properly initialized.

   User Action: Refer to the SYS$MANAGER:LTLOAD.COM command procedure
   that is included with your LAT/VMS distribution software.

NOTINMACRO

statement not in MACRO body

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A .NARG, .ENDM, or .ENDR directive is used outside
   the context of a macro.

   User Action: Correct the code.

NOTINPHYS

'location' not in physical memory

   Facility: SDA, System Dump Analyzer

   Explanation: The memory location you requested as a parameter to
   the SDA command EXAMINE is not in physical memory when the system
   failed.

   User Action: Reenter the command, specifying another address.

NOTINSTALL

writeable shareable images must be installed

   Facility: SYSTEM, VMS System Services

   Explanation: Writable shareable images must be installed.

   User Action: Install the shareable image specifying /SHARE/WRITE.

NOTINTBLSZ

block size is greater than 2048

   Facility: SYSTEM, VMS System Services

   Explanation: Your block size is greater than 2048 bytes (the
   default).

   User Action: For a block size greater than 2048 bytes, you must
   specify the number of blocks required with the /BLOCK qualifier as
   shown below:

   MOUNT/BLOCK=n

NOTIRPAQB

Not IRP pointer in AQB

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTJOURNAL

'filespec' is not a BACKUP journal

   Facility: BACKUP, Backup Utility

   Explanation: The specified file does not have the appropriate file
   attributes. It is not a Backup Utility journal file.

   User Action: Locate the correct file and reenter the command.

NOTLABEL

'volume-label' not on 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: The operator responded to a message from the magnetic
   tape ACP with a successful completion, but the volume is not
   correct. The volume label specified by the original DCL command
   MOUNT, or the reply to an operator mount request, does not match
   the volume label on the specified device.

   User Action: Include the correct label in the next reply to
   an operator mount request or mount the correct volume on the
   device. If you do not want to check the label, use the OVERRIDE:ID
   qualifier in the original DCL command MOUNT. Verify that the
   device is on line.

NOTLABELMT

tape is not labeled

   Facility: SYSTEM, VMS System Services

   Explanation: A request to read a tape failed because the tape does
   not have standard labels.

   User Action: Verify the tape volume. Mount the tape as a foreign
   tape, if necessary, to read it. If the tape is to be rewritten,
   initialize it before retrying the program.

NOTLEARNING

you have not begun a learn sequence

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedure LEARN_END executed without the
   built-in procedure LEARN_BEGIN preceding it.

   User Action: You must start a learn sequence before you can save
   keystrokes.

NOTLGLISOP

not a legal listing option

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The argument to a .SHOW, .NOSHOW, .LIST, or .NLIST
   directive is not a legal option.

   User Action: Delete the illegal option or replace it with a legal
   option.

NOTLKB

Structure is not an LKB

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTLOADED

LAT terminal port driver (LTDRIVER) is not loaded

   Facility: LATCP, LAT Control Program

   Explanation: You attempted to start the LAT port driver before
   loading the driver with the SYSGEN CONNECT command.

   User Action: Use the SYSGEN CONNECT command to connect the LAT
   port driver. Start the LAT port driver again. For information
   about using the SYSGEN command, see the SYS$MANAGER:LTLOAD.COM
   command procedure that is included with your LAT/VMS distribution
   software.

NOTLOCKED

'filename' not locked

   Facility: SET, SET Facility

   Explanation: The file that you want to lock is already locked.

   User Action: None.

'filespec' is not locked

   Facility: Shared by several facilities

   Explanation: The file specified by a DCL command UNLOCK is not
   locked. This message is informational.

   User Action: None.


NOTMOD

volume 'volume-name' not modified

   Facility: SET, SET Facility

   Explanation: The volume is not modified. This message is
   accompanied by another message.

   User Action: Take corrective action based on the accompanying
   message.

NOTMODIFIABLE

attempt to change unmodifiable buffer 'string'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You cannot change the specified buffer.

   User Action: Use the SET (MODIFIABLE, . . . ) built-in to allow
   modifications.

NOTMODIFIED

no pages in the section were modified

   Facility: SYSTEM, VMS System Services

   Explanation: The update request completed successfully without
   queueing any I/O requests because no pages in the input address
   range had been modified.

   User Action: The operating system does not normally display this
   message; the user program should be able to detect and respond to
   the condition.

NOTMOUNTED

volume 'volume-name' has not been mounted on EXCHANGE

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility received a DISMOUNT command for
   a volume which is not mounted.

   User Action: Check the command for a misspelled device name.

NOTMPMBX

operation requires TMPMBX privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires TMPMBX privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOTMTLMTL

Corrupted mounted volume list

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTNEG

qualifier or keyword not negatable-remove "NO" or omit

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The word "NO" preceded a qualifier or keyword, but
   the qualifier or keyword cannot be specified as a negative.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary for a list of negatable qualifiers and keywords.

NOTNETDEV

not a network communication device

   Facility: SYSTEM, VMS System Services

   Explanation: The device specified is not a network communications
   device, and the control function cannot be performed.

   User Action: Check for a programming error. Verify that the device
   specified in the queue I/O request is a valid communications
   device.

NOTNUMBER

parameter 'name' is not numeric type

   Facility: SYSBOOT, System Bootstrap Facility and SYSGEN, System
   Generation Utility

   Explanation: A numeric value is specified in a SET command for a
   non-numeric parameter.

   User Action: Reenter the command specifying a correct parameter
   value.

NOTNUMCAP

not a numeric capability

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler expected a numeric capability
   name but encountered something else.

   User Action: Check your terminal definition. Perhaps you have
   misspelled the numeric capability name or omitted another
   statement, such as STRING or BOOLEAN which would have terminated
   numeric capabilities.

NOTOBJLIB

file 'filename' is not an object library

   Facility: LINK, Linker Utility

   Explanation: The specified file is not an object library. The
   linker processes only object and shareable image libraries.

   User Action: Specify only object or shareable image libraries.

library 'library-name' is not an object library

   Facility: LIBRAR, LIBRARY Command

   Explanation: An attempt is made to cross-reference a library or to
   use the /REMOVE qualifier in a macro, help, or text library.

   User Action: Reenter the command line, specifying an object
   library that contains the requested symbol.


NOTODS2

'qualifier' qualifier invalid on Files-11 Structure Level 1 disk

   Facility: SET, SET Facility

   Explanation: The specified qualifier is not valid for a Files-11
   Structure Level 1 volume, file, or directory.

   User Action: Reenter the command specifying a valid qualifier.

NOTONSCREEN

text cannot be scrolled unless window is on screen

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are trying to use the built-in procedure SCROLL
   on a window that is either not mapped to the screen, or is totally
   occluded by other windows.

   User Action: Map the window to the screen before using the built-
   in procedure SCROLL.

NOTORIGSRC

original version of source file not found file used is 'filespec'

   Facility: DEBUG, VMS Debugger

   Explanation: A source file was found for some module. But the
   revision date and time or the file size indicates that this
   may not be the same version of the file that was used in the
   original compilation of the module. This warning message indicates
   that future source line displays from this source file may not
   correspond to the actual source used to compile the module.

   User Action: None, unless the original source is available. Then
   you can use the SET SOURCE command to indicate the location of the
   source to DEBUG.

NOTPARAM

not a parameter file

   Facility: SYSGEN, System Generation Utility

   Explanation: The file specified in the SYSGEN command USE is not a
   valid parameter file.

   User Action: Use a valid parameter file that is either provided by
   VMS or created by the SYSGEN command WRITE in SYSGEN.

NOTPASTED

given display is not pasted to given pasteboard

   Facility: SMG, Screen Management Facility

   Explanation: An attempt is made to unpaste or move a display that
   is not pasted to the specified pasteboard.

   User Action: Check that you are referencing the correct virtual
   display. Verify that the display has not been unpasted or that you
   forgot to paste it.

NOTPATADR

patch address is 'addr1' not 'addr2'

   Facility: PATCH, Patch Utility

   Explanation: You typed the incorrect starting address of the patch
   area.

   User Action: To determine the correct starting address, enter
   either the PATCH command SHOW PATCH_AREA or the PATCH command
   ALIGN/BYTE. When you enter the PATCH command ALIGN/BYTE, PATCH
   defines a symbol as the current starting address.

NOTPCB

Structure not PCB

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTPRINTED

failed to queue spool file for print

   Facility: SYSTEM, VMS System Services

   Explanation: An error occurred while an implicitly spooled file is
   queued for print. The file has not been printed and the data is
   lost.

   User Action: The system manager should ensure that the job
   controller works correctly and that the printer or terminal is
   spooled to the correct queue.

NOTPSECOPT

not a valid PSECT option

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The attribute specified in the .PSECT directive is
   invalid.

   User Action: Delete the invalid attribute or replace it with a
   valid one.

NOTPSECT

relocation base set to other than psect base in module 'module-name'
file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module specified other than a psect base in
   a set relocation base command.

   User Action: Submit a Software Performance Report (SPR). Include
   the appropriate language compiler in the Report (SPR).

NOTPTR

variable must be of pointer or file type

   Facility: DEBUG, VMS Debugger

   Explanation: The variable should be a pointer or a file type.

   User Action: Specify a variable of pointer or file type.

NOTQUEUED

request not queued

   Facility: SYSTEM, VMS System Services

   Explanation: The $ENQ system services request, specifying the flag
   bit LCK$M_NOQUEUE, could not be granted.

   User Action: Wait and retry the operation.

NOTQUO

unquoted argument not allowed in ASCII or INSTRUCTION modes

   Facility: PATCH, Patch Utility

   Explanation: While in ASCII or INSTRUCTION mode, you entered an
   argument not enclosed within matching apostrophes or quotation
   marks.

   User Action: Add matching apostrophes or quotation marks to your
   argument and reenter.

NOTRACES

no tracepoints are set, no opcode tracing

   Facility: DEBUG, VMS Debugger

   Explanation: There are no tracepoints or opcode tracing set. This
   message is informational.

   User Action: None.

NOTRAN

logical name cannot be translated

   Facility: INIT, INITIALIZE Command and MOUNT, Mount Utility

   Explanation: The DCL command MOUNT or INITIALIZE attempted logical
   name translation on a device name or logical name and failed to
   translate the logical name. This error is most likely to occur
   when logical names are nested too deeply or if a logical name is
   assigned to itself.

   User Action: Use the DCL command SHOW LOGICAL to verify the
   translation of the device name or logical name. If necessary,
   reassign the logical name before reentering the DCL command MOUNT
   or INITIALIZE.

no string translation performed

   Facility: SYSTEM, VMS System Services

   Explanation: A request to translate a logical name returned with
   no translation performed. The system returns the input logical
   name string as the equivalence name string. (Because this is a
   success message, it is not normally displayed.)

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

no translation for logical name 'name'

   Facility: SHOW, SHOW Command

   Explanation: There is no translation for the specified logical
   name.

   User Action: None.



NOTREADIN

you are not reading a message

   Facility: MAIL, Mail Utility

   Explanation: The MAIL command you typed, (DELETE, FILE, FORWARD,
   PRINT, or REPLY) is appropriate only when you are reading a
   message.

   User Action: Read the desired message using the MAIL command READ
   and then enter the appropriate command in response to the MAIL>
   prompt.

NOTRELVOL

relative volume 'nnn' not on device

   Facility: MOUNT, Mount Utility

   Explanation: Each volume in a volume set has a relative number
   beginning with one. The volume mounted on the device is not the
   relative volume requested in the previous mount request.

   User Action: Mount the correct volume on the device, or abort the
   mount request if you do not have the correct volume.

NOTRENAMED

'filename' not renamed

   Facility: RENAME, RENAME Command

   Explanation: The specified file is not renamed.

   User Action: Correct the error according to the accompanying
   message.

NOTRES

process swapped out

   Facility: SDA, System Dump Analyzer

   Explanation: This message occurs if the process name specified in
   a SHOW PROCESS or SET PROCESS command represents a process that is
   swapped out of the balance set when the system failed.

   User Action: None.

NOTRMSOUT

RMS is not being used to perform output

   Facility: SMG, Screen Management Facility

   Explanation: SMG$SNAPSHOT is used with files and unknown devices
   to capture the contents of the pasteboard at various times. If
   SMG$SNAPSHOT is called for a pasteboard associated with a video
   terminal, then it takes no action and returns this informational
   message.

   User Action: None.

NOTRULUCB

Bad RUL pointer in UCB (journaling)

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTRVTVCB

Not RVT pointer in VCB

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTSAMEBUF

the markers are not in the same buffer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You passed markers to the built-in procedure CREATE_
   RANGE that are not in the same buffer. A range cannot span
   buffers.

   User Action: Create the range with markers in the same buffer.

NOTSAMEDEV

cannot RENAME to a different device

   Facility: RENAME, RENAME Command

   Explanation: An attempt is made to rename a file name from one
   device to another.

   User Action: Use the DCL command COPY instead of the DCL command
   RENAME.

input and output must be same device for boot copy

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an attempt to COPY
   /BOOT between devices.

   User Action: Reenter the command, specifying the same device for
   input and output. You can also omit the name of the output device,
   since EXCHANGE will assume you mean the same as the input device.


NOTSAVED

'LMB-name' not saved in the dump file

   Facility: SDA, System Dump Analyzer

   Explanation: Information corresponding to a Logical Memory Block
   (LMB) has not been saved in this subsetted dump file. The dump
   file may or may not be useful for analysis depending on which LMB
   was not saved. If the SDA image retains control after the error,
   then some analysis is possible, but some information might not be
   available in the dump file.

   User Action: None. The dump file may not be useful for analysis.

NOTSAVESET

'save set spec' is not a BACKUP save set

   Facility: BACKUP, Backup Utility

   Explanation: The specified file does not have the appropriate file
   attributes. It is not a save set.

   User Action: Locate the correct file and reenter the command.

NOTSEQ

output file is not a sequential file

   Facility: CONVERT, Convert Utility

   Explanation: You specified the /APPEND qualifier and the output
   file is not sequential.

   User Action: Specify /NOAPPEND and try again.

NOTSET

LAT terminal port driver multicast data not set

   Facility: LATCP, LAT Control Program

   Explanation: The LATCP Utility did not attempt to set the LTDRIVER
   parameter area because of a previous error.

   User Action: Correct the error condition that prevented the
   parameter area in LTDRIVER from being initialized.

process not set to /CPU=[NO]ATTACHED

   Facility: Shared by several facilities

   Explanation: The process is already in the requested state.

   User Action: None.


NOTSHDWDEV

not a shadowing device

   Facility: MOUNT, Mount Utility

   Explanation: There are two possible causes for this error message:
   (1)The form DSA was not used to specify the virtual unit name in
   the mount command, causing the mount command to fail, or (2)An
   attempt was made to mount a volume that does not support volume
   shadowing in a shadow set (for example, a magnetic tape cannot
   become a shadow set member).

   User Action: Correct the command syntax and enter the command
   again.

NOTSHRIMG

file 'filename' is not a shareable image

   Facility: LIBRAR, LIBRARY Command

   Explanation: The file given as input to a shareable image library
   is not a shareable image.

   User Action: Relink the image using the LINK/SHARE option.

NOTSPLADDR

memory at 'address' does not begin a spin lock structure

   Facility: SDA, System Dump Analyzer

   Explanation: The memory at the specified address to the SDA
   command SHOW spin locks does not contain the type field
   corresponding to a spin lock structure.

   User Action: Reenter the command; specify a different address.

NOTSQDEV

not a sequential device

   Facility: SYSTEM, VMS System Services

   Explanation: You tried sequential access with a random access
   device.

   User Action: Use random access with this device.

NOTSTARTED

LAT terminal port driver not started

   Facility: LATCP, LAT Control Program

   Explanation: Your attempt to start the LAT port driver is
   unsuccessful.

   User Action: Determine the specific cause of the failure and
   reenter the command.

NOTSTOPPED

LAT terminal port driver not stopped

   Facility: LATCP, LAT Control Program

   Explanation: A STOP NODE command failed to stop the LAT protocol.

   User Action: Determine the specific cause of the failure and
   reenter the command.

NOTSTRCAP

not a string capability

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler expected a string capability
   name but encountered something else.

   User Action: Check your terminal definition. Perhaps, you have
   misspelled the string capability name or omitted another statement
   such as BOOLEAN or NUMERIC which would have terminated string
   capabilities.

NOTSTRUCT1

qualifiers not available with structure level 1

   Facility: INIT, INITIALIZE Command

   Explanation: This message is generated by the DCL command
   INITIALIZE. Qualifiers were used requesting features not available
   with Files-11 Structure Level 1, for example, /CLUSTER and
   /DATACHECK.

   User Action: Use structure level 2 or omit the qualifiers.

NOTSYSTEM

you are not logged in to the SYSTEM account.

   Facility: VMSINSTAL, Install Procedures

   Explanation: When VMSINSTAL begins an installation, it makes
   sure that you are logged in to the SYSTEM account. This check
   has failed.

   User Action: You will be asked if you want to continue the
   installation. DIGITAL recommends that you correct this situation
   before continuing.

NOTUCBIRP

not UCB pointer in IRP

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTUCBRVT

not UCB pointer in RVT

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTUCBUCB

corrupted UCB list

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTUCBWCB

Bad UCB pointer in window

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTUICFMT

user id parameter does not translate to UIC format

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The user specification in your command does not
   translate to a UIC identifier (an identifier in UIC format).

   User Action: Determine why the user specification is not a UIC-
   format ID. You can display user names and their corresponding UIC
   values by using the AUTHORIZE command SHOW.

NOTUQPORT

device not connected to a UNIBUS/Q-bus port

   Facility: SET, SET Facility

   Explanation: You entered the DCL command SET DEVICE/DFAG for a
   device other than a UDA50 controlled disk, a RC25, or a TU81. This
   command is valid only for these devices.

   User Action: Check the device number. Make sure it is one of the
   devices listed above.

NOT_USABLE

this log will not be used as it is currently named

   Facility: LMCP, Log Manager Control Program

   Explanation: A log file that has not been created in directory
   SYS$JOURNAL or is not named SYSTEM$node-name cannot be used as a
   log file.

   User Action: Consult your system manager about naming and locating
   log files.

NOTVALID

information not in physical memory

   Facility: SDA, System Dump Analyzer

   Explanation: The virtual address you specified is not currently in
   physical memory or is not in physical memory at the time of the
   dump. You are not able to examine the address.

   User Action: None.

NOTVALLEN

fixed record length of 'numeric-string' is too large

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility discovered a value on a /RECORD_
   FORMAT=(FIXED=n) command which is too large.

   User Action: Reenter the command with a smaller record length.

NOTVCBUCB

not VCB pointer in UCB

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTVOLSET

volume is not part of a volume set

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt is made to reference a specific volume in
   a volume set, through the file ID or placement control, when the
   specified volume is not part of a volume set.

   User Action: Verify that the correct device name is specified or
   remove the volume-specific reference.

volume on 'device-name' not in volume set 'volume-label'

   Facility: MOUNT, Mount Utility

   Explanation: The file set identifier of the first file in a volume
   set identifies the volume set. The volume mounted on the device is
   not part of the specified volume set.

   User Action: Mount the correct volume on the device, or abort the
   mount request if you do not have the correct volume.


NOTVVPVCB

not volume virtual page pointer in VCB

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTWCBIRP

not WCB Pointer in IRP

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTWCBWCB

corrupted WCB list

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOTYET

not yet implemented

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in being used has not yet been implemented.

   User Action: You must use a different built-in that has been
   implemented.

NOUNIQUE

symbol 'symbol-name' is not unique

   Facility: DEBUG, VMS Debugger

   Explanation: The symbol specified was not in a default scope or
   was defined in more than one scope.

   User Action: Specify the scope of the symbol in a path name or
   change the default scope.

NOUNLOAD

driver is not unloadable

   Facility: SYSGEN, System Generation Utility

   Explanation: Either an attempt is made to reload a driver that is
   marked unloadable (DPT$M_NOUNLOAD) in the driver prologue table,
   or the unload routine of the driver indicates that the driver
   should not be unloaded.

   User Action: None.

NOUPDATE

no patch for update qualifier ECO level 'nn'

   Facility: PATCH, Patch Utility

   Explanation: When a command procedure is submitted for interactive
   or batch execution (by typing PATCH/UPDATE = (eco-level, . . . )),
   an ECO level is specified that is not included in the command
   procedure.

   User Action: Check your command procedure for correct ECO levels
   and retry.

NOUSERNAME

missing user name

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The command you are using requires a user name.
   A user name is the member name from the alphanumeric form of a
   user's UIC (user identification code).

   User Action: Reenter your command including a user name.

username must be supplied

   Facility: MOM, Maintenance Operation Module

   Explanation: In this LOOP NODE or LOOP EXECUTOR command, a user
   name must be supplied.

   User Action: Supply a user name with the LOOP command.


NOUSERPASS

username and password must be supplied

   Facility: MOM, Maintenance Operation Module

   Explanation: In this LOOP NODE or LOOP EXECUTOR command, both a
   user name and a password must be supplied.

   User Action: Supply a user name and a password with the LOOP
   command.

NOUSERSPEC

missing user specification

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The command you are using requires a user
   specification. A user specification may be a user name (for
   example, CAESAR), or a user identification code (for example,
   [100,44]).

   User Action: Reenter your command including a user specification.

NOUSRWCS

no user WCS halt restart

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

NOVALATPC

entity 'symbol-name' does not have a value at the current PC (was
optimized away)

   Facility: DEBUG, VMS Debugger

   Explanation: The value of the specified variable does not exist at
   this point in the program's execution. For example, the variable
   might be assigned to a register that is currently being used for
   some other purpose.

   User Action: Retry the operation at a point in the program's
   execution when the variable is being referenced.

NOVALPRS

$SEARCH operation not preceded by valid $PARSE

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS wildcard $SEARCH operation was attempted
   with no preceding valid $PARSE operation.

   User Action: Verify that the sequence of VMS RMS service calls
   is coded correctly and that the NAM block is not inadvertently
   modified during execution of the program.

NOVALU

value not allowed-remove value specification

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A qualifier or keyword that does not accept a value
   is specified with a value.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary for the correct syntax and reenter the command.

NOVALUE

'keyword' keyword requires a value

   Facility: Shared by several facilities

   Explanation: The keyword indicated must be specified with a value.

   User Action: Reenter the command; specify a value for the
   indicated keyword.

qualifier 'qualifier' requires value

   Facility: BACKUP, Backup Utility

   Explanation: No value was given for the specified qualifier.

   User Action: Specify a value for the qualifier and reenter the
   BACKUP command.

reference does not have a value

   Facility: DEBUG, VMS Debugger

   Explanation: The command specified a reference that has no value.

   User Action: Change the reference.



NOVECTOR

no vector processor(s) available to test

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test failed to detect
   any presence of vector processors or the vector emulator facility
   installed on the host system. Either a VAX vector processor(s) or
   vector emulator facility has not been properly installed or is not
   available.

   User Action: Refer to the vector emulator facility installation
   reference manual, or run diagnostics for VAX Vectors, or contact
   Digital customer service.

NOVER

no file version obtained for 'filespec'

   Facility: INSTALL, Install Utility

   Explanation: INSTALL could not obtain the file version number of
   the image file for the known file entry being listed.

   User Action: Ensure that the image file exists, and check the file
   protection.

NOVIRMEM

error allocating virtual memory

   Facility: DUMP, File Dump Utility

   Explanation: The File Dump Utility encountered an error during
   an attempt to allocate dynamic virtual memory. The accompanying
   message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command. The account's page file quota or the SYSGEN
   parameter VIRTUALPAGECNT may need to be increased.

NOVOLDATA

volume summary data for 'device-name' not found-/IMAGE cannot be
used

   Facility: BACKUP, Backup Utility

   Explanation: In a restore operation with the /IMAGE qualifier, no
   volume initialization data exists. Either the save set is created
   without the /IMAGE qualifier, or save set data has been lost.

   User Action: Attempt to recover data without the /IMAGE qualifier.
   If this error occurs during a disk-to-disk (copy) operation, it
   indicates a software error in the Backup Utility; in this case,
   submit a Software Performance Report (SPR).

NOVOLPRO

operation requires VOLPRO privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires VOLPRO privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NOVOLUMES

no volumes are currently mounted

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility could not show mounted volumes,
   because none were mounted.

   User Action: Only use the EXCHANGE SHOW command if there is
   something to show.

NOWATCHES

no watchpoints are set

   Facility: DEBUG, VMS Debugger

   Explanation: No watchpoints are set. This message is
   informational.

   User Action: None.

NOWATTAR

cannot watch-protect target

   Facility: DEBUG, VMS Debugger

   Explanation: You are attempting to set a watchpoint on a location
   that is either not in your program or is on the stack (P1 space).
   These two kinds of locations cannot be watchpointed.

   User Action: None, unless you specified the wrong location.

NOWBPT

cannot insert breakpoint

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).

NOWILD

no wildcard permitted

   Facility: Shared by several facilities

   Explanation: Wildcards are not permitted in this context.

   User Action: Respecify using exact file specifications.

NO_WINASSOC

no viewport has been associated with the display

   Facility: SMG, Screen Management Facility

   Explanation: A viewport window is not associated with the virtual
   display.

   User Action: Create a viewport on the virtual display.

NOWINDOW

attempt to position the cursor outside all of the mapped windows

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You can move the cursor only to a position inside a
   mapped window.

   User Action: Move the mouse inside a window, and attempt position
   to the mouse again.

NOWOPCO

cannot replace breakpoint with opcode

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).

NOWORLD

operation requires WORLD privilege

   Facility: SYSTEM, VMS System Services

   Explanation: A command or program requested a system function that
   requires WORLD privilege; the current process does not have this
   privilege.

   User Action: If the message is in response to a command entered
   interactively, verify that you have not used a command or a
   qualifier for a particular command that requires a specific user
   privilege.

   If the message occurs during the execution of a program, determine
   the system service call that resulted in the error. Verify that
   you have not used a service or an argument for a particular
   service that requires a user privilege that you do not have.

   In either case, correct the command or program so that you do not
   request the privileged function. If you determine that you need
   the privilege for an application, contact your system manager to
   obtain the necessary privilege.

NO_WRK

work files required, cannot do sort in memory as requested

   Facility: SORT, Sort/Merge Utility

   Explanation: The /WORK-FILES=0 qualifier is specified indicating
   the data would fit in memory, but the data is too large.

   User Action: Either increase the working set quota, or allow the
   Sort Utility to use two or more work files.

NOWRT

cannot create writeable section to read-only file

   Facility: SYSTEM, VMS System Services

   Explanation: An image file that is read-only opened contains a
   writeable section. You cannot create a writeable section to a
   read-only file.

   User Action: Close and open the file correctly. If the Install
   Utility returns this error, reenter the command but use the /WRITE
   qualifier in addition to /SHARE qualifier.

NPK

no primary key defined for indexed file

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $CREATE service is executed for an indexed
   file and no primary key XAB definition is provided.

   User Action: Verify that the VMS RMS service is coded correctly.

NSADDR

address 'addr' is not within image

   Facility: PATCH, Patch Utility

   Explanation: You specified an address outside the address range of
   the image file.

   User Action: Retry the operation specifying the correct address.

NSF

.END LIST/.END NOTE not in same file as .LIST/.NOTE: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You made an illegal attempt to start a list or note
   in one file and end it in another.

   User Action: End the list or note in the same file where you
   started it.

NTD

files nested too deep: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You attempted to nest .REQUIRE files more than 10
   deep.

   User Action: Reduce the number of nested .REQUIRE files.

NUDFENVS

'number' undefined environments:

   Facility: LINK, Linker Utility

   Explanation: Undefined environments were encountered by the linker
   at the end of Pass 1.

   User Action: Ensure that all referenced environments are defined.

NUDFLSYMS

'number' undefined module-local symbols:

   Facility: LINK, Linker Utility

   Explanation: Undefined module-local symbols were encountered by
   the linker at the end of Pass 1.

   User Action: Ensure that all referenced module-local symbols are
   defined.

NUDFSYMS

'number' undefined symbols:

   Facility: LINK, Linker Utility

   Explanation: Undefined symbols were encountered by the linker.
   This message is issued at the end of Pass 1 of the link.

   User Action: Ensure that all symbols referenced are defined.

NULFIL

missing or invalid file specification-respecify

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The command interpreter expected a file specification
   following an execute procedure symbol (@),  a prompting message,
   a plus sign (+),  or a comma (,), but no file specification is
   entered.

   User Action: Reenter the command; put the file specification in
   the proper position.

NULIDX

index is empty

   Facility: LBR, Librarian Subroutine Package

   Explanation: The specified index is found empty on a call to
   LBR$GET_INDEX. Processing continues.

   User Action: None.

NULLFILE

file 'filespec' contains no records

   Facility: SEARCH, SEARCH Command

   Explanation: The specified file is empty. This may be because the
   file is currently being written by another process. This message
   is informational.

   User Action: None.

NULLPRI

null primary block

   Facility: FDL, Create/FDL Utility and FDL, Edit/FDL Utility

   Explanation: You specified a primary that requires secondaries,
   but none were given.

   User Action: Specify secondaries for the primary.

NULLPRIV

no privileges specified-no action taken

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A SET PROFILE command specified neither a change in
   privileges nor a change in the default device or directory.

   User Action: Reenter the command with the appropriate qualifiers.

NULLSTRING

null string used

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A null string was used where a non-null string is
   required.

   User Action: Enter a non-null string.

NULSAVESET

null save set name specified to RESTORE_SAVESET.

   Facility: VMSINSTAL, Install Procedures

   Explanation: A product installation procedure contained an
   incorrect call to RESTORE_SAVESET.

   User Action: Contact your DIGITAL field service representative.

NUMBER

invalid numeric value-supply an integer

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A numeric value is specified for a DCL command that
   expects values in certain radices, or interprets values within a
   particular context. For example, the number 999 is entered when an
   octal value is required. Or an alphabetic value is specified in a
   context that requires a numeric value, for example, a file version
   number.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary for the legal values and reenter the command.

NUMELEMENTS

number of elements incorrect for component

   Facility: LIB, Library Facility

   Explanation: You specified an incorrect number of elements for the
   component.

   User Action: Examine the arguments to LIB$INIT_DATE_TIME_CONTEXT.
   Begin debugging procedures to verify and correct the problem.

Numeric value illegal

   Facility: EDT, EDT Editor

   Explanation: You specified a number that is too large for the
   command specifier.

   User Action: Reenter the command specifying a valid value.

Numeric value required

   Facility: EDT, EDT Editor

   Explanation: The command did not have a numeric value at the point
   of
   the ^ in the command.

   User Action: Reenter the command specifying a numeric value at the
   point of the ^.

NUM_KEY

too many keys specified

   Facility: SORT, Sort/Merge Utility

   Explanation: Up to 255 key definitions are allowed. Either too
   many key definitions have been specified or the NUMBER value is
   wrong.

   User Action: Check your command string key field specifications.

NUMOPRNDS

'xx' instructions must have 'nn' operands

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: An operand is omitted from the MACRO-11 instruction.
   If the debugger issues this message, a DEBUG command DEPOSIT
   specified the 'xx' instruction with an incorrect number of
   operands. This instruction requires 'nnn' operands.

   User Action: Reenter the command with the correct number of
   operands.

NUMTRUNC

number truncated

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: The PATCH Utility or the Debugger truncated a numeric
   data entry because it exceeded the length of the data type.

   User Action: None.

NUMVAL

error code of 'xx' requesting update value

   Facility: PATCH, Patch Utility

   Explanation: A command interpreter callback request failed due to
   the error code represented as 'xx'.

   User Action: Retry the request using the correct error code
   (represented as 'xx').

NVROPRFAI

the last NVR operation has failed

   Facility: DTK, DECtalk Facility

   Explanation: A NVR operation failure occurred since the DECtalk
   device was turned on.

   User Action: Check the DECtalk hardware.

OBJ

invalid object identification

   Facility: NCP, Network Control Program

   Explanation: The identification of the object is not a valid
   object name.

   User Action: Check the syntax rules for object identifiers, and
   reenter your command with the correct object identifier.

OBJLOCKED

object currently locked by another user

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt is to modify the access control list (ACL)
   of an object while another user is modifying the object's ACL.

   User Action: Repeat the operation at a later time.

OBSSERVERDB

obsolete audit server database 'n.n' encountered; new database
created

   Facility: AUDSRV, Audit Server

   Explanation: An obsolete audit server database file was
   encountered by the audit server process during its initialization
   processing. A new database was created. The displayed numbers
   indicate the major and minor database version numbers.

   User Action: The site security administrator should insure that
   the permanent audit server characteristics are correctly set in
   the new server database.

OBTEVT

error when reading raw events

   Facility: EVL, Event Logger

   Explanation: NETACP returned an error while EVL is reading
   unprocessed events. This message may be accompanied by a secondary
   message indicating a system configuration or process quota problem
   with the EVL process.

   User Action: Ensure that EVL has adequate quota and that the VMS
   system is configured properly. The account under which EVL runs is
   specified in the network Configuration Data Base.

OCCLUDED

built-in/keyword 'name' occluded by declaration

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You declared a parameter, local, or constant that has
   the same name as a built-in or keyword. Your declaration obstructs
   the built-in or keyword.

   User Action: None.

OCVNOTFND

output converter not found

   Facility: CDA,

   Explanation: The specified output converter could not be found.

   User Action: Check the format specified for the output file for
   errors. See if the file SYS$LIBRARY:'domain'$WRITE'format'.EXE
   exists, where 'domain' is DDIF for document formats or DTIF for
   tabular formats and 'format' is the output format specified by the
   calling application or the CONVERT/DOCUMENT command line.

ODS2SAVE

save set disk on 'device-name' must be structure level 2

   Facility: BACKUP, Backup Utility

   Explanation: The specified volume is not a Files-11 Structure
   Level 2 volume. The volume cannot be used as a save set disk.

   User Action: Retry the operation using a properly initialized
   Files-11 Structure Level 2 volume.

OFFHOOK

telephone is offhook (active)

   Facility: DTK, DECtalk Facility

   Explanation: This is an informational message telling you that the
   phone is off the hook (a call is active).

   User Action: None.

OFFLINE

'device-name' : offline

   Facility: MOUNT, Mount Utility

   Explanation: The given device is off line. The requested action
   cannot be completed.

   User Action: Place the device on line and reenter the command.

OK_ALK

record is already locked

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS request to lock a record returns this
   success status code when the specified record is already locked.
   This is a success status.

   User Action: None.

OK_DEL

deleted record successfully accessed

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS request to access a deleted record returns
   this success status code when the specified record is accessed.
   This is a success status.

   User Action: None.

OK_DUP

record inserted had duplicate key

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $PUT or $UPDATE service completed
   successfully. The record inserted or updated had one or more key
   values that duplicated the values of other records. This is a
   success status.

   User Action: None.

OK_IDX

index update error occurred

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $PUT or $UPDATE service completed
   successfully. However, the index could not be completely updated.
   No access paths to the record have been lost; access to the record
   will take longer.

   User Action: The status value (STV) field of the RAB contains the
   VMS RMS error that occurred during index update. Take corrective
   action based on that value. File reorganization with the CONVERT
   command is recommended to improve performance.

OK_LIM

retrieved record exceeds specified key value

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $GET or $FIND request returns this success
   code if the retrieved record exceeds the specified key value and
   if the RAB$V_LIM option is specified. This is a success status.

   User Action: None.

OK_NOP

XAB not filled in for block I/O

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $OPEN or $DISPLAY service that specified
   block I/O access (BIO) completed successfully. However, one or
   more key definition or allocation XABs were not filled in. This is
   a success status.

   User Action: None.

OK_RLK

record locked but read anyway

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS request to read a locked record completed
   successfully. This is a success status.

   User Action: None.

OK_RNF

nonexistent record successfully accessed

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS request to access a nonexistent record
   completed successfully. This is a success status.

   User Action: None.

OK_RRL

record locked against read but read anyway

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS request to read a record locked against
   read is completed successfully. This is a success status.

   User Action: None.

OK_WAT

record locked after wait

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS request to access a record locked after
   wait completed successfully. This is a success status.

   User Action: None.

OLDINSCHK

memory location 'addr' not equal to 'xx'

   Facility: PATCH, Patch Utility

   Explanation: The verification of the contents of the given address
   failed.

   User Action: Reenter the PATCH command specifying the correct
   value.

OLDLIBRARY

old format library opened

   Facility: LBR, Librarian Subroutine Package

   Explanation: This success message is generated by the Librarian
   routines when a library that is not in the current format is
   opened.

   User Action: None.

OLDMISMCH

old format library type mismatch

   Facility: LBR, Librarian Subroutine Package

   Explanation: The requested Version 1.0 library is a different type
   from the type expected. Processing continues based on the actual
   library type.

   User Action: None.

OLDPURGE

security auditing resources exhausted; oldest message purged

   Facility: AUDSRV, Audit Server

   Explanation: The audit server internal message buffer has been
   exhausted. As a result, the audit server has chosen to purge the
   oldest security alarm from its internal buffer in an attempt to
   preserve the newest alarms.

   User Action: None. This event results from the server FINAL_ACTION
   setting of PURGE_OLD.

OLDTAB

command tables have obsolete format-use SET COMMAND to recreate

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: CLI encountered a command table with an obsolete
   format while trying to automatically update it to the current
   format. The obsolete command table must be manually updated.

   User Action: Use Command Definition Utility command SET COMMAND to
   recreate the tables.

OLDVALCHK

memory location 'addr' not equal to 'xx'

   Facility: PATCH, Patch Utility

   Explanation: The verification of the contents of the given address
   failed.

   User Action: Reenter the PATCH command specifying the correct
   value.

On output page pn; on input line 'ln' of page 'pn' of file 'filename'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This is a standard error message line that specifies
   the location of an error string. This message indicates the number
   of the page (pn) in the output file affected by the error and the
   name of the input file (filename), including the input page (pn)
   and the line number (ln) in which the error occurred.

   User Action: Find and correct the error string.

ONCOMD

ON command too large-decrease the length of the THEN clause

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The command action for an ON command in a command
   procedure is too complex to be evaluated or too large to be
   stored.

   User Action: Correct the command procedure simplifying the ON
   command action.

ONDELRECLIST

attempt to access a record on the deleted list

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

ONEDELTIM

at least one delta time is required

   Facility: LIB, Library Facility

   Explanation: The LIB$DATE_TIME routine requires at least one of
   the inputs to be a delta time.

   User Action: Examine each argument. Determine which argument is
   incorrect and replace it with a delta time.

ONEENTQUE

one entry in queue

   Facility: LIB, Library Facility

   Explanation: The procedure successfully completed. An entry is
   added to the front of the queue. As a result, the queue contains
   one entry.

   User Action: None.

ONEF11DEV

both input and output must not be save sets

   Facility: BACKUP, Backup Utility

   Explanation: When you executed the BACKUP command, you specified
   that both input and output files reference a save set. Either the
   input or the output specification, not both, can reference a save
   set.

   User Action: Reenter the command.

ONEF11OUT

file-structured output must not be a list

   Facility: BACKUP, Backup Utility

   Explanation: The output specification for a copy, restore, or
   compare operation without the /IMAGE qualifier is a list of file
   specifications. (BACKUP does not accept this.)

   User Action: Modify your output specification and reenter the
   command.

ONEIMGDEV

the /IMAGE qualifier input specification must not be a list

   Facility: BACKUP, Backup Utility

   Explanation: The specification for an input volume set to
   be processed with the /IMAGE qualifier is a list of file
   specifications. (BACKUP does not accept this.)

   User Action: Modify your input specification and reenter the
   command.

ONELEARN

cannot start a learn sequence while one is active

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You can create only one learn sequence at a time.

   User Action: Terminate the current learn sequence before starting
   a new one.

ONEPHYDEV

the /PHYSICAL qualifier specification must not be a list

   Facility: BACKUP, Backup Utility

   Explanation: The specification for a physical volume is a list of
   file specifications. (BACKUP does not accept this.)

   User Action: Modify your specification and reenter the command.

ONERR

invalid ON condition-use WARNING, SEVERE, ERROR or CONTROL_Y

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The keyword specified in the DCL command ON to
   indicate the condition is not recognized.

   User Action: Correct the DCL command ON, using one of the
   keywords- CONTROL_Y, WARNING, ERROR, or SEVERE_ERROR.

ONESELECT

select already active, maximum 1 per buffer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You used the built-in procedure SELECT a second time
   within the same buffer.

   User Action: Set the previous select mark to 0 or delete the
   current select range with the DELETE built-in procedure.

ONEVAL

list of values not allowed-check use of comma (,)

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A qualifier, keyword, or parameter that accepts only
   a single value is specified with multiple values.

   User Action: Reenter the command specifying only one value.

ONHOOK

telephone is onhook (inactive)

   Facility: DTK, DECtalk Facility

   Explanation: This is an informational message telling you that the
   phone is on the hook (no call is active).

   User Action: None.

ONLEVL

invalid ON context-use only within command procedures

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An ON command is issued interactively. It can be
   issued only from within a command procedure.

   User Action: None.

ONOVF

no room for ON command-symbol overflow, delete some symbols

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Symbol or keypad definitions have exhausted the
   command interpreter's space for storing values.

   User Action: If necessary, interrupt the command procedure with
   CTRL/Y and stop its execution. Use the DCL commands SHOW SYMBOL
   and SHOW KEY to determine how many global symbols and keypad
   symbols are defined; delete unused symbols to recover symbol table
   space.

   If the error occurs frequently, simplify the command procedure or
   procedures. Use local symbols within procedures whenever possible.

OPCCUS

opcode reserved to customer fault at PC = 'location', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An operation code beginning with ^XFC is encountered
   during execution of an image. This message indicates an exception
   condition and is usually followed by a display of the condition
   arguments, registers, and stack at the time of the exception.

   User Action: Examine the PC and virtual address displayed in the
   message to determine the instruction that caused the error.

OPCDEC

opcode reserved to DIGITAL fault at PC = 'location', PSL =
'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: The operation code at the indicated address is
   not known. This message indicates an exception condition and
   is usually followed by a display of the condition arguments,
   registers, and stack at the time of the exception.

   User Action: Examine the PC and virtual address displayed in the
   message to determine the instruction that caused the error.

OPEFAI

operation failure 'error'

   Facility: NCP, Network Control Program

   Explanation: The requested operation failed for the reason
   identified in the 'error' part of the message.

   User Action: Take corrective action based on the system-specific
   error message.

OPEJBCMBX

error opening job controller mailbox

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error assigning
   a channel to its mailbox. The accompanying message provides
   additional information.

   User Action: Take action based on the accompanying message.

OPENBITMAP

error opening BITMAP.SYS, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to open the storage bit map file, [000000]BITMAP.SYS;1, on
   the specified relative volume. The accompanying message provides
   additional information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.

OPENDIR

error opening directory 'directory-name'

   Facility: BACKUP, Backup Utility and ANALDISK, Analyze/Disk_
   Structure Utility

   Explanation: Either the Backup Utility or the Verify Utility
   encountered an error during an attempt to open the specified
   directory file. The accompanying message provides additional
   information. The Backup Utility cannot process files in this
   directory or its subdirectories.

   User Action: Correct the condition that caused the error and
   reenter the command line.

error opening parent directory for 'directory-name'

   Facility: SET, SET Facility

   Explanation: A parent directory could not be opened.

   User Action: Take corrective action based on the accompanying
   message.


OPENEXC

error opening exception file 'filespec'

   Facility: CONVERT, Convert Utility

   Explanation: This message will be accompanied by an RMS message
   that explains the error.

   User Action: Correct the error described by the RMS message and
   try again.

OPENFDL

error opening 'filename'

   Facility: FDL, Create/FDL Utility and FDL, Edit/FDL Utility

   Explanation: This message will be accompanied by an RMS message
   that explains the error.

   User Action: Correct the error described in the RMS error message
   and try again.

OPENFILE

error creating event file 'file-id'

   Facility: EVL, Event Logger

   Explanation: An error occurred while creating an event file. All
   events destined for that sink will be discarded. This message
   displays the name of the file. This message is issued with an
   accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

file ('file-id') 'filename' error opening file for read check

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during
   an attempt to open the specified file to execute the /READ_
   CHECK function. The accompanying message provides additional
   information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.


OPENFOREIGN

unable to open 'device-name' as a foreign volume

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encounted an RMS error while
   trying to $OPEN or $CONNECT to a foreign-mounted device.

   User Action: This message will be followed by one or two lines
   of RMS error messages. Please take corrective action based on the
   actual error condition that RMS discovered.

OPENIN

error opening 'filename' as input

   Facility: FDL, Edit/FDL Utility

   Explanation: An input file cannot be opened. This message is
   usually accompanied by an RMS message indicating the reason for
   the failure.

   User Action: Take corrective action based on the associated
   message.

'input-filespec' open error

   Facility: LIBRAR, LIBRARY Command

   Explanation: One of the following conditions prevented the DCL
   command LIBRARY from opening the input file:

   o  The user directory is protected against read operations.

   o  A physical device problem occurred; for example, the volume is
      not mounted.

   o  The specified directory does not exist.

   o  The specified file does not exist.

   o  Create or compress operations do not allow enough room or quota
      to allocate the new library file.

   User Action: Correct the problem and reenter the command line.

error opening 'filespec' as input

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The assembler encountered an I/O error when opening
   an input source or macro library file; filespec is the file
   specification of the file being opened. This message is produced
   when the file cannot be found.

   User Action: Retry the assembly or make a new copy of the input
   file and try the assembly.

error opening 'input-filespec' as input

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The file could not be opened for input. The message
   should be accompanied by a VMS RMS message indicating why the
   error occurred.

   User Action: Follow the recovery procedure for the specified VMS
   RMS message.

error opening 'input-filespec' as input

   Facility: Shared by several facilities

   Explanation: An input file cannot be opened. This message is
   usually accompanied by a VMS RMS message indicating the reason
   for the failure.

   User Action: Take corrective action based on the associated
   message.





OPENINDEX

error opening INDEXF.SYS, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to open the index file, [000000]INDEXF.SYS;1, on the
   specified relative volume. The accompanying message provides
   additional information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.

OPENMON

error creating logical link to monitor process 'sink-name'

   Facility: EVL, Event Logger

   Explanation: An error occurred while establishing a logical link
   to a sink monitor program. The program image or command file
   may not be present. All events destined for that sink will be
   discarded.

   User Action: Take corrective action based on the accompanying
   message.

OPENOUT

error opening 'output-filespec' as output

   Facility: Shared by several facilities

   Explanation: An output file cannot be opened. This message is
   usually accompanied by a VMS RMS message indicating the reason for
   the failure.

   User Action: Take corrective action based on the associated
   message.

error opening 'filespec' as output

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The assembler encountered an I/O error when opening
   an output object module or listing file; filespec is the file
   specification of the file being opened. The message is produced
   when the device is write locked or is not mounted.

   User Action: Retry the assembly. If the error is reproducible,
   notify your system manager.

error opening 'output-filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: During a VMS RMS operation, an error is encountered
   while opening an output file.

   User Action: Determine that the file is open and that you have
   WRITE privilege to it.

error opening 'output-filespec' as output

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The file could not be opened for output. The message
   should be accompanied by a VMS RMS message indicating the reason
   for error.

   User Action: Follow the recovery procedure for the specified VMS
   RMS message.

unable to create, open, or connect to an output

   Facility: ACCOUNTING, Accounting Utility

   Explanation: An output file cannot be opened. This message is
   usually accompanied by a VMS RMS message indicating the reason for
   the failure.

   User Action: Take corrective action based on the associated
   message.





OPINPROG

previously requested operation is incomplete

   Facility: SYSTEM, VMS System Services

   Explanation: A request could not be completed due to the
   outstanding context requests of the service.

   User Action: Do not specify the same context argument on
   concurrent calls.

OPENQUOTA

error opening QUOTA.SYS

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during
   an attempt to open the quota file, [000000]QUOTA.SYS;1, on
   relative volume 1. The accompanying message provides additional
   information. This condition is normal if quotas are not enforced
   on the volume.

   User Action: If necessary, correct the condition that caused the
   error and reenter the Verify Utility command line.

OPENUAF

error opening user authorization file

   Facility: INPSMB, Input Symbiont

   Explanation: The system encountered an error opening the user
   authorization file to validate a batch job entered from a card
   reader. The accompanying message provides additional information.

   User Action: Consult your system manager.

OPENVIRTUAL

unable to open 'filename' as a virtual volume

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an RMS error while
   trying to $OPEN or $CONNECT to a Files-11 file being used as a
   virtual device.

   User Action: This message will be followed by one or two lines
   of RMS error messages. Please take corrective action based on the
   actual error condition that RMS discovered.

OPER1

OPER1

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued when operator
   status is requested either explicitly by the
   REPLY/STATUS command or implicitly as with the
   REPLY/ENABLE command. It indicates that the operator's terminal is
   enabled for "CARDS" class operations.

   User Action: None.

OPER10

OPER10

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER11

OPER11

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER12

OPER12

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER2

OPER2

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER3

OPER3

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER4

OPER4

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER5

OPER5

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER6

OPER6

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER7

OPER7

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER8

OPER8

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPER9

OPER9

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued optionally with the OPERSTS
   message. It describes the classes of operator requests that the
   current operator is enabled to act upon.

   User Action: None.

OPERABORT

operator has aborted request, reply is 'reply'

   Facility: BACKUP, Backup Utility

   Explanation: The operator has aborted or canceled the request.

   User Action: Determine the reason for the cancellation from the
   reply given in the message and proceed accordingly.

OPERASSIST

operator assistance has been requested

   Facility: BACKUP, Backup Utility

   Explanation: This message notifies you that operator assistance
   has been requested.

   User Action: None.

OPERFAIL

error requesting operator service

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to interact with the operator. The accompanying message
   provides additional information. The error may be caused because
   the operator replied to the request with REPLY/ABORT.

   User Action: Correct the condition that caused the error and
   reenter the command.

OPERREQ

OPER privilege required for /ACCESSED qualifier

   Facility: SET, SET Facility

   Explanation: OPER privilege is required for this qualifier.

   User Action: See your system manager about obtaining OPER
   privilege.

OPERSPEC

specify option ('options')

   Facility: BACKUP, Backup Utility

   Explanation: This message is returned to the operator. It
   indicates that BACKUP has encountered a recoverable error. The
   operator must select one of the options listed in the message.
   The possible options are QUIT, CONTINUE, and RESTART. If the
   QUIT option is selected, BACKUP will terminate. If the CONTINUE
   option is selected, BACKUP will ignore the error and continue
   processing. If the RESTART option is selected, BACKUP will restart
   the operation at the beginning of the current volume.

   User Action: The operator should evaluate the preceding errors and
   select the appropriate option.

OPERSTS

operator status for operator 'operator-name'

   Facility: OPCOM, Operator Communication

   Explanation: This message displays information in response to the
   DCL command REPLY/STATUS entered by an operator.

   User Action: None.

OPINCOMPL

operation is incomplete

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with a status code
   returned from a DR11-W interface operation. A block mode transfer
   operation completed without transferring the requested number of
   bytes. The DR11-W generated an end-of-transfer interrupt without
   transferring all the data. This message results from a hardware
   error.

   Some disk devices can also return this message. On a WRITE request
   the XE unit has not completed restarting after a hardware failure.

   Some magnetic tape devices can also return this message if there
   is an attempt to read beyond the logical end of volume.

   User Action: Check for a hardware error. Wait a few seconds before
   entering another WRITE request.

OPNERR

open error code of 'xx' on file 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: A VMS RMS $OPEN request failed due to the error code
   represented as 'xx'.

   User Action: Correct the error code (representing as xx) and
   retry.

OPNOTPERDOS

operation not permitted on DOS-11 volume 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered a command which
   could not be performed on a DOS-11 volume, such as a RENAME or
   DELETE command.

   User Action: Think of something else that you want to do, since
   EXCHANGE will not perform the operation.

OPNOTSUP

operation not supported by RMS Extension

   Facility: RMS, VMS Record Management Services

   Explanation: An extended RMS component has been requested to
   perform a service it is incapable of performing. For example,
   attempting to do a $PUT to a file coded with DDIF semantics.

   User Action: Verify that the application program is not attempting
   to modify the data file.

operation is not supported on this device

   Facility: SMG, Screen Management Facility

   Explanation: The requested operation cannot be performed, since
   the terminal hardware does not support this feature.

   User Action: Run the application on a terminal that supports this
   feature.

OPNOTPERF11

operation not permitted on Files-11 volume 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered a command which
   could not be performed on a Files-11 volume, such as a DELETE or
   DIRECTORY command.

   User Action: Think of something else that you want to do, since
   EXCHANGE will not perform the operation.


OPNSNK

unable to open link to event receiver

   Facility: EVL, Event Logger

   Explanation: An error occurred when EVL attempted to open a
   logical link to an event receiver on a sink node. The sink node
   may not be reachable in the network, or the VMS system or network
   may be misconfigured.

   User Action: Take correction action based on the accompanying
   message.

OPRABORT

mount aborted by operator

   Facility: MOUNT, Mount Utility

   Explanation: This is the final message in a series of messages
   issued from MOUNT to the operator. The operator has refused your
   request.

   User Action: None.

OPREPL

'reply'

   Facility: OPCOM, Operator Communication

   Explanation: This is the operator's reply to a user's request or
   question.

   User Action: Determined by the operator's reply.

OPREPLY

'message-text'

   Facility: MOUNT, Mount Utility

   Explanation: An operator's response to the DCL command REQUEST is
   displayed on the terminal. This message is informational.

   User Action: None.

operator reply is 'string'

   Facility: BACKUP, Backup Utility

   Explanation: The operator replied to an operator request with the
   text string contained within quotes in the message.

   User Action: None.


OPRNDLNG

operand 'xx' too long for internal buffers

   Facility: PATCH, Patch Utility

   Explanation: An internal PATCH error has occurred.

   User Action: Submit a Software Performance Report (SPR).

OPRNDSYNX

operand syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: An operand contained a syntax error.

   User Action: Correct the operand syntax.

OPRNOTIF

operator notified, waiting.. 'system time'

   Facility: OPCOM, Operator Communication

   Explanation: The DCL command REQUEST is entered with the /REPLY
   qualifier; the request has been sent and displayed on the
   operator's terminal. You cannot enter any commands until the
   operator responds to your request.

   User Action: If you want to interrupt the request, press CTRL/C
   and enter another message to the operator or press CTRL/Z to
   cancel the request.

OPRQST

operator request: 'request'

   Facility: MOUNT, Mount Utility

   Explanation: This message announces an operator request. This
   message is informational.

   User Action: None.

OPRQSTCAN

operator request canceled

   Facility: MOUNT, Mount Utility

   Explanation: You canceled your request by pressing CTRL/Y; this
   canceled the MOUNT request.

   User Action: None.

OPRQSTDON

operator request canceled-mount completed successfully

   Facility: MOUNT, Mount Utility

   Explanation: The operator request is canceled because the request
   is completed.

   User Action: None.

OPRSNDERR

error sending request to operator

   Facility: MOUNT, Mount Utility

   Explanation: MOUNT failed in an attempt to send a message to the
   operator. This message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

OPSYNTAX

instruction operand syntax error

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: There is a syntactical error in an operand within an
   instruction. Or the DEBUG command DEPOSIT contained an instruction
   with an operand syntax error.

   User Action: Correct the syntax and retry.

OPTARGMIS

missing argument in options file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A required argument for an option is missing.

   User Action: Correct the option line and relink.

OPTIGNSHR

option ignored for shareable image

   Facility: LINK, Linker Utility

   Explanation: An option that does not apply to a shareable image is
   specified in an options file. The linker ignores the option when
   creating a shareable image.

   User Action: Remove the option from the options file.

OPTIGNSYS

option ignored for system image

   Facility: LINK, Linker Utility

   Explanation: You specified an option in an options file that is
   ignored for system images.

   User Action: Remove the option.

OPTLIN

options line in error 'text' 'text' 'text'

   Facility: LINK, Linker Utility

   Explanation: Errors were found on the command line during options
   file processing.

   User Action: None.

OPTSYNERR

syntax error in options file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A syntax error is detected in the options file. The
   next line of the error message displays the line in error.

   User Action: Correct the error and relink.

OPTVALERR

'name' option value 'decimal-number' is out of range ('decimal-
number' to 'decimal-number') in options file 'file -name'

   Facility: LINK, Linker Utility

   Explanation: An option specified an illegal value.

   User Action: Correct the option line and relink.

ORDER

routine called out of order

   Facility: CONVERT, Convert Utility

   Explanation: You have called one of the callable routines out of
   order. The required order is CONV$PASS_FILES, CONV$PASS_OPTIONS,
   and CONV$CONVERT.

   User Action: Fix the order and try again.

ORDER_ERROR

record state invalid in transaction sequence

   Facility: LMCP, Log Manager Control Program

   Explanation: The transaction log file lists transaction states in
   an invalid sequence, for example, a prepare state is listed after
   a commit state.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and include a BACKUP
   save set containing the output of the LMCP DUMP command for the
   given log file and the output of the DCL DUMP command for the same
   log file.

ORG

invalid file organization value

   Facility: RMS, VMS Record Management Services

   Explanation: An invalid file organization is encountered on a
   $OPEN system service or specified for a $CREATE system service.
   Files must be either sequential, relative, or indexed, unless
   block I/O processing is requested.

   User Action: Verify that the call to the VMS RMS system service is
   coded correctly.

ORIGINAL line numbers no longer an EDT feature

   Facility: EDT, EDT Editor

   Explanation: EDT has been revised to enable users to edit
   sequence-numbered files and to retain the sequence numbers for
   future work. The new capabilities replace the original line number
   feature.

   User Action: None.

OSCTOOLON

operating system command string too long in record 'record-number'

   Facility: PSM, Print Symbiont

   Explanation: This status is returned indicating operating system
   command string is longer than allowed in this record number.

   User Action: None.

OUTCMDLNG

output command line too long for buffer

   Facility: PATCH, Patch Utility

   Explanation: An internal PATCH error has occurred.

   User Action: Submit a Software Performance Report (SPR).

OUTCONERR

output conversion error

   Facility: OTS, General Purpose Facility

   Explanation: The result would have exceeded the fixed-length
   string.

   User Action: Increase the length of the fixed-length string and
   retry the operation.

OUTORDER

key or area primary defined out of order in statement 'number'

   Facility: FDL, Create/FDL Utility, FDL, Edit/FDL Utility

   Explanation: If there are two or more AREA sections, they must be
   in ascending order by area number and must follow each other. If
   there are two or more KEY sections, they too must be consecutive
   and adjacent.

   User Action: Fix the order.

OUTPUT

command execution on node 'nnnnnn'

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A DO command generated output from node 'nnnnnn'. The
   output follows this message.

   User Action: If you do not want to see the output, press CTRL/C to
   return to the SYSMAN> prompt.

Output file could not be closed

   Facility: EDT, EDT Editor

   Explanation: EDT opened the output file and copied the MAIN buffer
   text into that file. However, for some reason at the system level,
   EDT cannot close that file.

   User Action: Correct the problem indicated in the accompanying
   message.

Output file could not be created

   Facility: EDT, EDT Editor

   Explanation: EDT could not create the output file with the file
   specification you supplied with the EXIT command. This error can
   be caused by problems in the file name itself (either it contains
   too many characters or it contains an invalid character). Other
   causes include problems in the directory specification, if you
   used one (either the directory does not exist, you do not have
   access to it, or the directory specification format is incorrect).
   This message could also mean that a problem with the file system
   exists, such as insufficient disk space.

   User Action: After determining the cause of the problem, correct
   it.

Output file could not be opened

   Facility: EDT, EDT Editor

   Explanation: EDT will display another message describing the
   error.

   User Action: Take corrective action based on the accompanying
   message.

OUTPUTLOST

output being lost, both NOTERMINAL and NOLOG are in effect

   Facility: DEBUG, VMS Debugger

   Explanation: The SET OUTPUT command has set the output conditions
   to NOTERMINAL and NOLOG; consequently, the output is not displayed
   on the terminal or written to a log file. The output normally
   displayed by the debugger will not be available.

   User Action: Use the SET OUTPUT command to send output to the
   terminal or to a log file.

OUT_RANGE

number cannot be less than 1 or larger than 127

   Facility: SYSGEN, System Generation Utility

   Explanation: You entered a SYSGEN command CONFIGURE with a number
   that is either too small or too large.

   User Action: Reenter the command specifying a number within the
   range of 1 to 127.

OUTSIMG

attempted store location 'address' is outside 'name' ('address' to
'address') in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An attempt is made to store outside the specified
   program segment. This may be caused by an attempt to initialize
   a shared COMMON of a shareable image when linking against the
   shareable image.

   User Action: Initialize the data either at execution time or when
   linking the shareable image containing the COMMON.

OUTSIMGP

attempted store location 'address' is outside 'name' ('address'
to 'address') in psect 'psect-name' module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: An attempt is made to store an address outside the
   specified program segment. This is generally due to an attempt
   to initialize a shared COMMON of a shareable image when linking
   against the shareable image. This message is issued if the psect
   name is known.

   User Action: Initialize the data at execution time.

OUTSTRTRU

output string truncated

   Facility: LIB, Library Facility

   Explanation: The source and destination strings are character
   coded text datum, and the destination string cannot contain all of
   the output string. The output string is truncated.

   User Action: None.

OUTSWPERR

outswap write error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

OVERFLOW

overflow in floating addresses, illegal configuration

   Facility: SYSGEN, System Generation Utility

   Explanation: The SYSGEN command CONFIGURE has computed an illegal
   floating address for a CSR or vector.

   User Action: Reenter the SYSGEN command CONFIGURE with the correct
   number of controllers.

OVERLAPRANGE

overlapping ranges, operation terminated

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The source and destination ranges of a COPY_TEXT
   or MOVE_TEXT overlap. The operation was terminated before any
   modifications were performed.

   User Action: Do not specify overlapping ranges to COPY_TEXT or
   MOVE_TEXT.

OVERLAY

'filespec' being overwritten

   Facility: Shared by several facilities

   Explanation: A file is being successfully overwritten. This
   message is a success return.

   User Action: None.

OVERWRITE

relative volume 'volume-name' on device 'device-name' will be
overwritten

   Facility: BACKUP, Backup Utility

   Explanation: This message notifies you that the volume header
   of the indicated volume will be overwritten with the information
   requested by the BACKUP command.

   User Action: None.

OVRALI

conflicting alignment on overlayed psect 'psect-name' in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: Different definitions of an overlayed psect contain
   different alignment specifications.

   User Action: Ensure that the specified psect has the same
   alignment in all modules referencing it.

OVRDSKQUOTA

disk usage exceeds disk quota

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with a status code
   returned by a file system ACP QIO request. Disk usage exceeds
   the specified quota.

   User Action: None.

OVRFLW

too much data-modify size of field or size of data

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A data value specified is larger than the area
   defined to receive it; for example, a DCL command DEPOSIT
   requested that a value larger than 1 byte be deposited in a 1-byte
   area.

   User Action: Verify the value and the area to receive it; correct
   the value or the receiving area and reenter the command.

OVRSIZ

oversized management command message

   Facility: NCP, Network Control Program

   Explanation: A message from NCP using the Network Information
   and Control Exchange (NICE) protocol is too long for the Network
   Management Listener (NML) to receive.

   User Action: Submit a Software Performance Report showing all the
   commands leading to this error.

PACTOOLONG

packed decimal string too long

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The numeric string in a .PACKED directive has more
   than 31 digits.

   User Action: Reduce the length of the decimal string.

PAD

PAD option ignored, output record format not fixed

   Facility: CONVERT, Convert Utility

   Explanation: You can pad records only with the FIXED record format
   in the output file.

   User Action: Either change the output file record format to FIXED,
   or do not specify a /PAD qualifier on the command line.

PAGECRIT

page file space critical, system trying to continue

   Facility: SYSTEM, VMS System Services

   Explanation: The system is running out of page file space. This
   message is more critical than the PAGEFRAG message.

   User Action: Create a new page file with more space. See the Guide
   to Setting Up a VMS System.

PAGEFRAG

page file badly fragmented, system continuing

   Facility: SYSTEM, VMS System Services

   Explanation: The system is running out of page file space.

   User Action: Create a new page file with more space. See the Guide
   to Setting Up a VMS System.

PAGEREDERR

page read error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

Pages written to 'filename'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This message indicates the number of pages written to
   the specified output file (filename).

   User Action: None.

PAGEWRTERR

page write error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PAGLIMEXC

page limit exceeded for zone

   Facility: LIB, Library Facility

   Explanation: Allocation exceeds the page limit for the zone.
   A LIB$GET_VM request has attempted to allocate more pages than
   specified by the page_limit attribute for the zone.

   User Action: Modify your program to allocate fewer pages, to
   create a zone with a higher page limit, or to request pages from
   another zone.

PAGNTRNVAL

page not in transition or valid

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PAGOWNVIO

page owner violation

   Facility: SYSTEM, VMS System Services and PTD, Pseudo Terminal

   Explanation: An image attempted to change a page in memory that is
   owned by a more privileged access mode. For example, an image
   executing in user mode attempted to delete a page owned by
   supervisor mode.

   User Action: Check for a programming error. Verify that pages
   referred to in system service calls are owned by the calling
   access mode.

PAGRDERR

page read error, reason mask = 'xx', virtual-address = 'location',
PC = 'location', PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: The system failed to read a page from disk into
   memory during a page fault operation. This message indicates
   an exception condition and is usually followed by a display of
   the condition arguments, registers, and stack at the time of the
   exception.

   User Action: Check the status of the device and repeat the
   request. Also check for a FORCEDERROR message on the image or
   in the page file by using the DCL command ANALYZE/DISK_STRUCTURE
   /READ_CHECK. If the failure persists, notify your system manager.

Parallel Path is Closing Virtual Circuit-REMOTE PORT 'xxx'

   Facility: VAXport, VAXport Driver

   Explanation: The Port Driver switched communications from a low
   performance communication link to a high performance communication
   link. This event is a normal virtual circuit shutdown.

   User Action: None.

PARENREQ

parenthesis required in 'DEBUG-command-segment'/TYPE:(X)'

   Facility: DEBUG, VMS Debugger

   Explanation: The 'DEBUG-command-segment' is either SET TYPE,
   DEPOSIT, or EXAMINE. You did not include parentheses in one of
   these commands.

   User Action: Place parentheses around the type of expression
   specified.

Parenthesis mismatch

   Facility: EDT, EDT Editor

   Explanation: The number of right parentheses [)] does not match
   the number of left parentheses [(]. This error occurs when you are
   entering a change mode command string.

   User Action: Modify your change mode command string to include an
   equal number of properly nested left and right parentheses.

PARGTMTCH

value of 'x' for /PARALLEL is greater than /MATCH value of 'y',
 /PARALLEL set to 'y'

   Facility: DIFF, DIFFERENCES Command

   Explanation: A /PARALLEL value is specified that is greater than
   the /MATCH value.

   User Action: Decrease the /PARALLEL value. The /PARALLEL value
   must always be less than or equal to the /MATCH value.

PARITY

disk boot driver parity error

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: There is a hardware error during a transfer from the
   satellite system disk.

   User Action: Check the error log for both the Ethernet and system
   disk, run diagnostics for the suspect hardware, or contact your
   DIGITAL field service representative.

parity error

   Facility: SYSTEM, VMS System Services

   Explanation: The exact meaning of this message depends on the
   device.

   If this message is associated with a status code returned by a
   request to a DR11-W interface, a parity error is detected in a
   block mode transfer when the Buffered Data Path of the UNIBUS
   adapter is purged.

   If this message is associated with a status code returned by a
   request to a DR32 interface, either the microcode is not loaded
   successfully or the DR32 controller detected a parity error and a
   hardware malfunction is indicated. The second longword of the I/O
   status block contains additional information pertaining to this
   malfunction for the DR32; the following bit values are associated
   with SS$_PARITY:

      XF$V_IOS_WCSPE
      XF$V_IOS_CIPE
      XF$V_IOS_DIPE
      XF$V_IOS_PARERR

   If this message is associated with a status code returned by a
   request to a disk driver, one or more of the following conditions
   can cause this error:

   o  Drive parity error

   o  ECC hard error

   o  Header compare error

   o  Map parity error

   o  Header CRC error

   o  MASSBUS control parity error

   If this message is associated with a status code returned by a
   request to a magnetic tape driver, one or more of the following
   conditions can cause this error:

      Attempt to read beyond the logical end of volume
      CRC error (NRZI only)
      Control bus parity error
      Correctable data error (PE only)
      Correctable skew (PE only)
      Data bus parity error
      Incorrectable error (PE only)
      Invalid tape mark (NRZI only)
      Nonstandard gap
      Longitudinal parity error (NRZI only)
      Format error (PE only)
      Vertical parity error (NRZI only)
      Map parity error
      MASSBUS control parity error
      MASSBUS data parity error
      Read data substitute

   If this message is associated with a status code returned by a
   request to an LPA11-K driver, a parity error occurred in a UBA-
   buffered datapath.

   If this message is associated with a status code returned by a
   request to a terminal driver, a parity bit mismatch is detected by
   the device interface during a read operation. The I/O operation
   stopped when the mismatch is detected. (Data is received up to
   this point in the operation.) SS$_PARITY is meaningful only on
   terminal lines that have parity enabled.

   User Action: Action depends on the type of device to which the I/O
   request is directed.


PARMDEL

invalid parameter delimiter-check use of special characters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command contains an invalid character following the
   specification of a parameter. Or an invalid character is present
   in a file specification.

   User Action: Check the command string for a spelling or
   grammatical error. Reenter the command.

PARNOTGRANT

parent lock must be granted

   Facility: SYSTEM, VMS System Services

   Explanation: A programming error has occurred because an attempt
   is made to create a sublock under a parent lock that is not
   granted.

   User Action: Correct the programming error and retry.

PARSE

error opening 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to access the specified file. The accompanying message
   provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

PARSEERR

internal parsing error

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: This message indicates either an internal PATCH error
   or an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).

unable to parse input name 'name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility attempted to interpret the given
   name as a file name, but is unable to do so successfully.

   User Action: This message is followed by a second message giving
   more specific information about why the name is not a valid file
   name. Take corrective action based on the additional message.


PARSEFAIL

error parsing 'filespec'

   Facility: Shared by several facilities

   Explanation: An error is detected while parsing an input command
   or source line.

   User Action: Correct the error.

error parsing 'filespec'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An error is detected by VMS RMS while parsing a file
   specification. This message should be accompanied by a VMS RMS
   message explaining the reason for the failure.

   User Action: Follow the recovery procedure for the specified VMS
   RMS message.


PARSEOVER

parser stack overflow

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The program is too complex for VAXTPU to evaluate.

   User Action: Simplify the expression.

Parsing stack overflow

   Facility: EDT, EDT Editor

   Explanation: The command you entered caused the memory space for
   the parse data to be filled before the command could be validated.

   User Action: Check your command string. If it is valid, reenter
   the command in segments.

PARSTKOVR

parse stack overflow, simplify expression

   Facility: DEBUG, VMS Debugger

   Explanation: The expression is too complex for the debugger to
   evaluate.

   User Action: Simplify the expression.

PARTCOPIED

file 'filename' partially copied to 'filespec'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility had copied part of a file before
   an error is discovered.

   User Action: This message is followed by another message
   describing the specific error which occurred. Take corrective
   action based on the second message.

PARTESCAPE

partial escape

   Facility: SYSTEM, VMS System Services

   Explanation: A terminal escape sequence is only partially stored
   because the buffer space is exhausted before the sequence is
   complete. The type-ahead buffer contains the remainder of the
   escape sequence unless the terminal line had the TT$M_NOTYPEAHD
   characteristic.

   User Action: Check for a programming error. Note the condition.
   Modify the source program, if necessary, to detect and respond to
   the condition.

PARTMAPPED

some file map pointers not permanently resident

   Facility: SYSTEM, VMS System Services

   Explanation: A call is issued to the $CRMPSC system service to
   map a section file; the ACP is unable to make all mapping pointers
   for the file permanently resident. The $CRMPSC call can be made
   directly or can be issued on the user's behalf when running an
   image.

   User Action: Either reduce the amount of fragmentation in the file
   (for example, by copying the file to a disk with a large amount
   of free space) or increase the process BYTCNT quota to allow the
   entire file to be permanently mapped.

PARTOOBIG

parameters too large-must be shortened

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: You attempted to add a startup component file that
   uses /PARAM qualifiers to specify a set of qualifiers with a total
   length that exceeds the maximum length allowed.

   User Action: Reenter the command using a smaller parameter set.

PART_SECTN

unable to interpret partially written section

   Facility: LMCP, Log Manager Control Program

   Explanation: The section being analyzed by LMCP failed the write
   check test, this determines if the section was completely written
   to the log file.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and include a BACKUP
   save set containing the output of the LMCP DUMP and the DCL DUMP
   commands for the given log file.

PASALREXI

pasteboard already exists for this device

   Facility: SMG, Screen Management Facility

   Explanation: A user tried to create a pasteboard for a device,
   when one is already created. This is normal in a modular
   environment. The existing pasteboard id is returned. Make sure
   you do not delete a pasteboard that you did not create.

   User Action: None.

Pass bad status to caller

   Facility: EDT, EDT Editor

   Explanation: While using callable EDT, the bad status is not
   passed to the calling program due to an error in EDT.

   User Action: Submit a Software Performance Report (SPR).

PATERR

internal patch coding error

   Facility: PATCH, Patch Utility

   Explanation: An internal PATCH error has occurred.

   User Action: Submit a Software Performance Report (SPR).

Path #0. Loopback has gone from BAD to GOOD

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: None.

Path #0. Has become working but CROSSED to Path #1.-REMOTE PORT 'xxx'

   Facility: VAXport, VAXport Driver

   Explanation: The Port Driver logs this event.

   User Action: Check for crossed-cable pairs.

Path #0. Has gone from BAD to GOOD

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: None.

Path #0. Has gone from GOOD to BAD

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: Check Path A cables for breaks or improper
   connections.

Path #0. Loopback has gone from GOOD to BAD

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: Check for crossed-cable pairs or faulty CI hardware.

Path #1. Loopback has gone from BAD to GOOD

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: None.

Path #1. Loopback has gone from GOOD to BAD

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: Check for crossed-cable pairs or faulty CI hardware.

Path #1. Has become working but CROSSED to Path #0.-REMOTE PORT 'xxx'

   Facility: VAXport, VAXport Driver

   Explanation: The Port Driver logs this event.

   User Action: Check for crossed-cable pairs.

Path #1. Has gone from BAD to GOOD

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: None.

Path #1. Has gone from GOOD to BAD

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver logs this event.

   User Action: Check Path B cables for breaks or improper
   connections.

PATHAMBIG

line 'line-number': Path 'path-name' is ambiguous

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a DISALLOW clause that referenced an
   ambiguous path. All DISALLOW path references must not be defined
   ambiguously.

   User Action: Edit the CLD file so that all DISALLOW path
   references are not ambiguous.

PATHLOST

path to network partner node lost

   Facility: SYSTEM, VMS System Services

   Explanation: The path to the remote node is lost due to too much
   network activity or communications problems.

   User Action: Wait, then check to see if the node is still
   reachable.

PATHTLONG

too many qualifiers on name

   Facility: PATCH, Patch Utility, and DEBUG, VMS Debugger

   Explanation: You entered a path name consisting of more than 15
   elements.

   User Action: Remove excess elements and retry.

PATHUNDEF

line 'line-number': Path 'path-name' refers to undefined verb or
syntax

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a DISALLOW clause which referenced
   an undefined verb or syntax. All DISALLOW references must be
   previously defined.

   User Action: Edit the CLD file so that all DISALLOW references are
   defined.

PATHUNRES

line 'line-number': Path 'path-name' cannot be resolved

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a DISALLOW clause that referenced
   an undefined path. All DISALLOW references must be previously
   defined.

   User Action: Edit the CLD file so that all DISALLOW references are
   defined.

PATOVER

pattern stack overflow

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A pattern that is being executed exceeds the maximum
   number (30) of active alternates.

   User Action: Reduce the number of active alternates.

PBDIN_USE

operation invalid while pasteboard is buffered

   Facility: SMG, Screen Management Facility

   Explanation: The operation you have tried to perform is not legal
   while output to the pasteboard is being batched. For example, you
   cannot change the pasteboard characteristics while the pasteboard
   is batched.

   User Action: Turn off pasteboard batching before attempting the
   operation. You may turn batching on again after the operation.

PBF

invalid prompt buffer

   Facility: RMS, VMS Record Management Services

   Explanation: The prompt buffer address of the RAB specifies an
   area of memory that cannot be read by the caller.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly. Specifically, check the address specified for the
   prompt buffer.

PC1

'filespec'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This message should never be displayed.

   User Action: Submit a Software Performance Report (SPR).

PC2

'n' index record[s] written to '.BRN filespec'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This informational message results from the use of
   /LOG.

   User Action: None.

PC3

'n' table-of-contents records written to '.BRN filespec'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This informational message results from the use of
   /LOG.

   User Action: None.

PDQUALERR

more than one display type qualifier specified for PROCESSES class

   Facility: MONITOR, Monitor Utility

   Explanation: The MONITOR command specified more than one of the
   display type qualifiers (/TOPBIO, /TOPCPU, /TOPDIO, /TOPFAULT) for
   the PROCESSES class. Only one of these qualifiers may be specified
   for each MONITOR request.

   User Action: Reenter the MONITOR command, specifying only one
   display type qualifier for the PROCESSES class.

PEAKUTIL

this product requires 'number' blocks during installation.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The installation procedure for the product determined
   that there are not enough free blocks on the system disk to
   install the product.

   User Action: Do the following:

   1. Purge and delete files to make more space on the system disk.

   2. Try to install the product again.

PENDING

asynchronous operation not yet completed

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont input
   routine indicating the requested function is accepted but not
   completed.

   User Action: None.

asynchronous operation not yet completed

   Facility: RMS, VMS Record Management Services

   Explanation: The program requested a VMS RMS asynchronous I/O
   operation; the operation is initiated but is not completed. This
   message is a success status code.

   User Action: None.


PERMSYM

deletion of permanent symbols not allowed

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You are trying to delete or redefine a permanent
   symbol. Permanent symbols are $STATUS, $SEVERITY, and $RESTART.
   Permanent symbol deletion is invalid.

   User Action: Do not try to delete or redefine these symbols.

PES

partial escape sequence

   Facility: RMS, VMS Record Management Services

   Explanation: The user buffer filled before a complete escape
   sequence is entered. The remainder of the escape sequence will
   be returned with the next input operation.

   User Action: Increase the size of the user record buffer to allow
   for escape sequences, or modify the program, if necessary, to
   recognize and respond to the condition.

PEXFULL

process exhaustion list full; requestor PID: 'pid'

   Facility: AUDSRV, Audit Server

   Explanation: The audit server process exclusion list is full.

   User Action: Use the SET AUDIT/NOEXCLUDE command to remove
   existing entries, and try again.

PFMBSY

page fault monitor is in use

   Facility: SYSTEM, VMS System Services

   Explanation: The page fault monitor has already been activated for
   your process or group.

   User Action: Request the page fault monitor only once per image
   invocation, or wait until the other user finishes.

PFNLISTCNT

inconsistent PFN list count

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PFNREFNZRO

PFN reference count nonzero

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PGFGBLBAD

pagefault, global page table entry bad format

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PGFIPLHI

pagefault with IPL too high

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PGFLOCBAD

pagefault, location field has bad value

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PHANOTFND

phase not found

   Facility: SMI, System Management Intergator/Server

   Explanation: A search for startup components running in a given
   phase found no matching entries.

   User Action: Reenter the command with a different /PHASE argument.

PHYDEVGEO

device type of 'device-name' does not match input

   Facility: BACKUP, Backup Utility

   Explanation: In an operation with the /PHYSICAL qualifier, the
   output device must be the same type as the input device.

   User Action: Reevaluate the operation; perhaps another mode of
   operation, such as using the /IMAGE qualifier, is appropriate. Or
   retry the operation specifying the same type of device.

PHYFILSPE

the /PHYSICAL qualifier specification must have only device name

   Facility: BACKUP, Backup Utility

   Explanation: When you used the /PHYSICAL command qualifier, you
   specified more than a device name as an input-specifier or output-
   specifier. The file specification for a volume to be processed
   with the /PHYSICAL qualifier must contain only a device name.

   User Action: Refer to the VMS Backup Utility Manual for
   information on the /PHYSICAL command qualifier and reenter the
   command.

PHYSET

physical save set supplied to nonphysical operation

   Facility: BACKUP, Backup Utility

   Explanation: You cannot use a save set created with the /PHYSICAL
   qualifier as input to an operation without specifying the
   /PHYSICAL qualifier.

   User Action: Use the DCL command BACKUP/LIST to determine how the
   save set is created. Reevaluate the operation, and reenter the
   command.

Please answer Y(es), N(o), Q(uit), or A(ll)

   Facility: EDT, EDT Editor

   Explanation: This prompt occurs when you have selected the QUERY
   qualifier and have failed to answer with one of the above in
   response to the question mark (?)  prompt.

   User Action: Respond to the prompt using either Y, N, Q, or A.

PLG

error detected in file's prolog (reconstruct file)

   Facility: RMS, VMS Record Management Services

   Explanation: The contents of the file have been corrupted because
   the file's prolog has been damaged.

   User Action: Reconstruct the file.

PLV

unsupported prolog version

   Facility: RMS, VMS Record Management Services, and CONVERT,
   Convert Utility

   Explanation: The version number field in the file's prolog read on
   open indicates that the file cannot be processed by this version
   of VMS RMS.

   User Action: Verify the version of VMS RMS that you are using; use
   the correct version to process the file.

unsupported prolog version

   Facility: CONVERT, Convert/Reclaim Utility

   Explanation: You have specified a Prologue 1 or Prologue 2 indexed
   file; CONVERT/RECLAIM works only with Prologue 3 indexed files.

   User Action: Specify a Prologue 3 file, or else use the CONVERT
   utility to reorganize the Prologue 1 or 2 file.


POOLEXPF

pool expansion failure

   Facility: SYSTEM, VMS System Services

   Explanation: Pool expansion failure occurs when the system runs
   out of nonpaged pool and there are not sufficient free pages for
   pool expansion.

   User Action: Examine the status of the small packet (SRP), I/O
   request packet (IRP), and large packet (LRP) lookaside lists, as
   well as pool status. Use the DCL command SHOW MEMORY/POOL/FULL
   to display memory status. You can extend the lists or pool by
   resetting the appropriate SYSGEN parameters. If you suspect disk
   fragmentation, use the Backup Utility to compress the disk.

Port Error Bits Set-CNF/PMC/PSR 'xxxxxxxx/xxxxxxxx/xxxxxxxx'

   Facility: VAXport, VAXport Driver

   Explanation: The port driver attempts to reinitialize the port;
   after 50 failed attempts, it marks the device off line.

   User Action: Check the error logs for a sanity timeout.
   This sanity timeout is indicated by bit 6 of the PSR (PSR =
   'xxxxxx4x'). The error logs describe the sanity timeout bit
   as a "Maintenance Timer Expiration." If sanity timeouts occur,
   check the console log to see whether the operator has halted
   and continued the system for any reason. If the console log does
   not show operator intervention, increase the PASTIMOUT SYSGEN
   parameter until the timeouts no longer occur. For nontimeout
   errors, call DIGITAL field service to check the port hardware.

Port has Closed Virtual Circuit

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver closes the virtual circuit that
   the local VAXport opened to the remote port.

   User Action: Check the PP$DB_STATUS field of the error log entry
   to see why the virtual circuit is closed. This error is normal if
   the remote system crashed or is shut down.

Port is going off line

   Facility: VAXport, VAXport Driver

   Explanation: The port driver has halted port operations because
   of an unrecoverable error or because the retry count has been
   exceeded.

   User Action: Examine the accompanying messages to determine the
   reason for the port shutdown. Take the necessary corrective action
   and reboot the system.

Port Power Down

   Facility: VAXport, VAXport Driver

   Explanation: The port driver detected a power down interrupt from
   the port.

   User Action: Call DIGITAL field service to check the port power
   supply.

Port Power Up

   Facility: VAXport, VAXport Driver

   Explanation: The port driver logs this event.

   User Action: None.

Port timeout

   Facility: VAXport, VAXport Driver

   Explanation: The port driver attempts to reinitialize the port;
   after 50 failed attempts, it marks the device off line.

   User Action: Call DIGITAL field service to check the port
   hardware, the CI cable, and the node number configuration.

Port Transition Failure-CNF/PMC/PSR 'xxxxxxxx/xxxxxxxx/xxxxxxxx'

   Facility: VAXport, VAXport Driver

   Explanation: The port driver attempts to reinitialize the port;
   after 50 failed attempts, it marks the device off line.

   User Action: Call DIGITAL field service to check the port
   hardware.

PORTRXERR

port receive error

   Facility: REM, Set Host Facility

   Explanation: The outgoing terminal line detected an error. This
   message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

Port ucode not at current rev level. PROM/RAM rev is 'xxxx/xxxx'

   Facility: VAXport, VAXport Driver

   Explanation: The port driver continues port operation.

   User Action: Check the console storage device for the latest
   microcode version. For ports with on-board microcode, call DIGITAL
   field service to upgrade the port microcode. Prolonged operation
   of the port with obsolete microcode is not supported by DIGITAL.

POS

invalid key position (greater than MRS) for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The position of a key segment specified by a key
   definition XAB is greater than the maximum record size specified
   for the file.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

POSERROR

error positioning 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to reposition the specified file. The accompanying message
   provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

POSITERR

error positioning 'save-set-spec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during
   an attempt to reposition the specified save set volume. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

POWERFAIL

power failure occurred

   Facility: SYSTEM, VMS System Services

   Explanation: A power failure occurred while a request is active
   or the device is powered down. If this message is associated with
   a status code returned by a request to an LPA11-K driver, a power
   failure occurred while a request is active. (Only for the start
   microprocessor, initialize LPA11-K, set clock, and start data
   transfer request functions.)

   User Action: If appropriate, rerun the program.

PRACCREM

proxies to 'user name' removed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Proxy access records for the specified user have
   been removed from the network authorization file. When a user name
   in the system user authorization file (SYSUAF.DAT) is removed,
   any corresponding records in the network authorization file
   (NETPROXY.DAT) are automatically removed at the same time.

   User Action: None.

PRACREN

proxies to 'user name' renamed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Proxy access records for the specified user have been
   renamed to the new user name. When a user name in the system user
   authorization file (SYSUAF.DAT) is renamed, any records in the
   network authorization file (NETPROXY.DAT) for the original user
   name are automatically renamed to the new user name.

   User Action: None.

PRCREAT

error creating process

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error in creating a
   process for a terminal that is attempting to log in. This failure
   usually occurs when there are no more process slots available in
   the system to create a new process.

   User Action: Try again later when fewer users are competing
   for system resources. Also, notify the system manager of this
   situation.

PREDEFREP

previous key-definition replaced

   Facility: SMG, Screen Management Facility

   Explanation: A previous key definition is replaced by a new
   definition.

   User Action: None.

PREMATUREEOF

premature end-of-file detected

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The program parsed correctly until the compilation
   stopped. However, the compilation stopped because the end of the
   program is reached prematurely (for example, before a closing
   ENDPROCEDURE statement).

   User Action: Correct the program format and then recompile.

PREMEOF

premature end-of-file encountered in options file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The options file ended before the end of a continued
   line is found.

   User Action: Correct the options file and relink.

premature end-of-file on /INPUT file

   Facility: MONITOR, Monitor Utility

   Explanation: The input recording file is either empty or does
   not contain the required control information because the MONITOR
   request that created the file is canceled prematurely. For
   example, a MONITOR request with a future beginning time could
   cause the process to hibernate and then get canceled.

   User Action: Verify that the file specified with the /INPUT
   qualifier is the MONITOR recording file you desired. Then, reenter
   the MONITOR request.


PREMMSG

record removed from NETPROXY.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The record specifed in the AUTHORIZE command REMOVE
   /PROXY has been removed from the network user authorization file.

   User Action: None.

PREPARED

only phase one commit processing completed

   Facility: SYSTEM, VMS System Services

   Explanation: The participant in the transaction has completed the
   first phase of the procedure to commit the transaction. This is an
   informational message.

   User Action: None.

PRESENT

entity value is present in command string

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This status is returned by the CLI$PRESENT CLI
   interface routine to indicate that the specified entity is
   explicitly present in the command line.

   User Action: None.

PREVDUPACE

previous ACE will supercede current ACE-not entered

   Facility: ACLEDIT, Access Control List Editor

   Explanation: An ACE already exists prior to the current position
   within the ACL and supercedes the ACE about to be entered,
   rendering it useless. The current ACE is not entered.

   User action: Modify the current ACE (or delete it), or modify the
   previous ACE.

PREVINIT

patch area has previously been initialized

   Facility: PATCH, Patch Utility

   Explanation: The patch area descriptor for the specified user-
   defined patch area has previously been initialized. PATCH set the
   patch area to the area named in the SET PATCH_AREA command, but
   did not initialize a new descriptor.

   User Action: Continue to enter patches into the user-defined patch
   area. To see the current status of the patch area, issue the SHOW
   PATCH_AREA command. In the future, do not use the /INITIALIZE
   qualifier if the descriptor has already been initialized.

PRIIHDBAD

invalid primary index file header, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the primary index file
   header on the specified relative volume is corrupted. The utility
   refreshes the primary index file header from the alternate index
   file header.

   User Action: None.

PRIMIN

error code of 'xx' parsing input file

   Facility: PATCH, Patch Utility

   Explanation: A command interpreter callback request failed due to
   the error represented as 'xx'.

   User Action: Correct the error (represented as 'xx') and retry.

PRIMNOSTP

PRIMARY CPU cannot be stopped

   Facility: SYSTEM, VMS System Services

   Explanation: The STOP/CPU command was used to stop a CPU, but the
   CPU cannot be stopped for one of the following reasons: 1) this is
   the only CPU in the system, 2) this is the primary CPU and primary
   switching is not supported by this system, or 3) the primary CPU
   owns a capability which no other CPU in the system owns.

   User Action: If the primary cannot be stopped because of
   capability ownership, and the system supports primary switching,
   the primary CPU can be stopped using the STOP/CPU/OVERRIDE_CHECKS
   qualifier.

PRIMOUT

error code of 'xx' parsing journal file

   Facility: PATCH, Patch Utility

   Explanation: A command interpreter callback request failed due to
   the error represented as 'xx'.

   User Action: Correct the error (represented as 'xx') and retry.

Print file could not be closed

   Facility: EDT, EDT Editor

   Explanation: EDT opened the output file and copied the text
   specified with the PRINT command into that file. However, for
   some reason at the system level, EDT is unable to close that file.

   User Action: Correct the problem indicated by the accompanying
   message.

Print file could not be created

   Facility: EDT, EDT Editor

   Explanation: EDT could not create the output file with the file
   specification you supplied with the PRINT command. This error can
   be caused by problems in the file name itself (either it has too
   many characters or an invalid character). Other causes include
   problems in the directory specification, if you used one (either
   the directory does not exist, you do not have access to it, or the
   directory specification format is incorrect). This message could
   also mean that there is a problem with the file system, such as
   insufficient disk space.

   User Action: Correct the problem indicated by the accompanying
   message.

PRINT

printer

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued when operator status is
   requested either explicitly by the REPLY/STATUS command or
   implicitly as with the REPLY/ENABLE command. It indicates that
   the operator's terminal is enabled for "PRINT" class operations.

   User Action: None.

PRISECMAP

private terminal table used

   Facility: SMG, Screen Management Facility

   Explanation: The requested terminal definition is found in the
   caller's private copy of Termtable.

   User Action: None.

PRIV

privilege error

   Facility: CNF, NI Configurator

   Explanation: NICONFIG is executing without all the necessary
   privileges.

   User Action: See the accompanying messages for the missing
   privileges. Install NICONFIG with all the required privileges
   or run from an account with all the required privileges.

PRIVINSTALL

shareable images must be installed to run privileged image

   Facility: SYSTEM, VMS System Services

   Explanation: Two possible reasons for this error follow:

   o  You tried to run a privileged image with uninstalled shareable
      images.

   o  You referenced an uninstalled shareable image when the main
      program is installed with the /EXECUTE_ONLY qualifier.

   User Action: Ask the system manager to install all shareable
   images used by executable images.

PRMEOF

premature end-of-file

   Facility: SUMSLP, SUMSLP Batch Editing Utility

   Explanation: A SUMSLP command file terminated unexpectedly. This
   is probably due to the absence of a terminator (/)  at the end of
   the command file.

   User Action: Insert a terminator (/)  at the end of the command
   file and edit again.

PRMLEN

parameter too long

   Facility: NCP, Network Control Program

   Explanation: A parameter string or value has too many characters.

   User Action: Reenter the command with appropriate parameter
   information.

PRMLON

parameter too long 'text'

   Facility: NCP, Network Control Program

   Explanation: A parameter value is too long for the implementation
   to handle. The 'text' part of the message identifies the low and
   high bytes of the parameter type number.

   User Action: Reduce the length of the parameter.

PRMMS

parameter missing 'text'

   Facility: NCP, Network Control Program

   Explanation: A required parameter in your command is missing. The
   'text' part of the message identifies which parameter is missing.

   User Action: Review the command description and reenter your
   command with the correct parameter.

PRMNA

parameter not applicable 'text'

   Facility: NCP, Network Control Program

   Explanation: Your parameter is not applicable to the component
   specified in the message. For example, you may have set a
   tributary address for point-to-point line or attempted to set
   a controller to loopback mode when the controller does not support
   that function. The 'text' part of the message identifies the
   parameter type.

   User Action: Review the command description and reenter the
   command with the correct parameter.

PRMRNG

parameter value out of range, 'parameter'

   Facility: NCP, Network Control Program

   Explanation: A numeric parameter value has an invalid range.
   The 'parameter' part of the message identifies which value is
   incorrect.

   User Action: Reenter the command with an appropriate parameter
   value.

PRO

invalid process identification

   Facility: NCP, Network Control Program

   Explanation: The format of the process identification is
   incorrect.

   User Action: Check the syntax rules for process identifiers and
   reenter your command with the correct process identifier.

PROCDONE

operation completed. Processing finished at 'date-time'

   Facility: BACKUP, Backup Utility

   Explanation: Standalone BACKUP processing has completed.

   User Action: None.

PROCESSEND

subprocess terminated

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A VMS subprocess that is successfully activated has
   been stopped. This condition can be caused by leaving VAXTPU,
   deleting the process, entering a LOGOUT command while in the
   subprocess, or having the subprocess stopped by another system
   user.

   User Action: None.

PROCFILE

processing file 'filename'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: This informational message indicates that DSR has
   begun processing the file.

   User Action: None.

PROCGONE

Process not in system

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PROC_ID

identification of created process is 'process-ID'

   Facility: RUN, Run Detached Utility

   Explanation: The newly created process has an identification
   number of 'process-ID'. This is an informational message.

   User Action: None.

PROCINDEX

error processing index file on 'device,' RVN 'n'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during
   an attempt to process the index file, [000000]INDEXF.SYS;1,
   on the specified relative volume of the specified device. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

PROCSUPERSEDED

definition of procedure 'name' superseded

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The procedure you are defining already had a
   definition. The new definition you supplied replaces the old one.

   User Action: None.

PRODNOTINS

optional software product 'name' not installed

   Facility: Shared by several facilities

   Explanation: The specified optional software product is not
   installed on your system.

   User Action: Install the requested software.

PRODSKIP

Products that have not been installed will be skipped.

   Facility: VMSINSTAL, Install Procedures

   Explanation: You requested that multiple products be installed,
   but one of these products requires that the system be rebooted
   after its installation. To accomplish this, the remaining
   uninstalled products must be skipped.

   User Action: Install the remaining products after the system is
   rebooted.

PROERR

error protecting 'filename'

   Facility: SET, SET Facility

   Explanation: An error occurred when the file's protection was set.

   User Action: Take corrective action based on the accompanying
   message.

prolog checksum error at VBN = 'nnn'

   Facility: CONVERT, Convert Utility and CONVERT, Convert/Reclaim
   Utility

   Explanation: The specified block of the file's prolog has been
   corrupted. This message will be accompanied by an RMS error
   message that explains the error.

   User Action: Correct the error described in the RMS error message
   and try again.


PROFRANOT

proper frame not found on call stack for 'path-name'

   Facility: DEBUG, VMS Debugger

   Explanation: You attempted to look at a variable in a routine
   invocation that does not exist.

   User Action: Specify a routine or routine invocation that is
   currently active.

PROGLOST

program lost-Sorry

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

PROL_WRT

prolog write error

   Facility: CONVERT, Convert Utility, CONVERT, Convert/Reclaim
   Utility

   Explanation: This message will be accompanied by an RMS error
   message that explains the error.

   User Action: Correct the error described in the RMS error message
   and try again.

PRONOTCHG

protection on 'filename' not changed

   Facility: SET, SET Facility

   Explanation: The protection on the file is not changed.

   User Action: Take corrective action based on the accompanying
   message.

PROTECTED

ACE cannot be modified

   Facility: ACLEDIT, Access Control List Editor

   Explanation: The current ACE is protected against deletion.
   This is usually because it is an application ACE or it is marked
   hidden.

   User Action: None.

'filename' file protection changed to 'protection'

   Facility: SET, SET Facility

   Explanation: The file protection has been successfully changed.
   This message is displayed when a SET FILE/PROTECTION command is
   entered with the /LOG qualifier.

   User Action: None.

protection on 'filespec' changed to 'protection-string'

   Facility: Shared by several facilities

   Explanation: This message is associated with the execution of a
   DCL command SET PROTECTION. The protection of the named file is
   changed to the value specified. This is an informational message.

   User Action: None.



PROTERR

internal protocol error

   Facility: REM, Set Host Facility

   Explanation: A system internal error has occurred.

   User Action: Submit a Software Performance Report (SPR).

PROTINSTALL

protected images must be installed

   Facility: SYSTEM, VMS System Services

   Explanation: Protected images must be installed.

   User Action: Use the /PROTECT qualifier to install a shareable
   image that contains user-written system services.

PROTMIS

server and host not running same SMI protocol version

   Facility: SMI, System Management Intergator/Server

   Explanation: Incompatible versions of SYSMAN and SMISERVER exist
   in the environment. Operation continues on the next node in the
   environment.

   User Action: Ensure that all nodes participating in a SYSMAN
   operation are running compatible versions of the VMS operating
   system or SMISERVER, or both.

PROTOCOL

remote protocol error-data packet w/o INIT

   Facility: SMI, System Management Intergator/Server

   Explanation: This message indicates an internal error. SMI is
   trying to use a remote link without sending an initialize packet.

   User Action: Submit a Software Performance Report showing all
   SYSMAN commands leading to this error.

network protocol error

   Facility: SYSTEM, VMS System Services

   Explanation: An error occurred attempting to initiate a DECnet-VAX
   logical link connection.

   User Action: Notify your software specialist. Refer to the VMS
   Networking Manual for additional information.


PROTOOLON

prompt-string is too long

   Facility: DTK, DECtalk Facility

   Explanation: The length of a prompt string exceeded 512
   characters.

   User Action: Shorten the prompt string to 512 characters or fewer.

prompt-string is too long

   Facility: SMG, Screen Management Facility

   Explanation: The length of a prompt string exceeded 512
   characters.

   User Action: Shorten the prompt to 512 characters or less.


PRTEXT

file only partially extended. Volume may be too fragmented.

   Facility: SYSGEN, System Generation Utility

   Explanation: The SYSGEN command CREATE failed. You have
   insufficient disk space.

   User Action: Clean up your disk space or specify a smaller /SIZE
   qualifier.

PRV

insufficient privilege or file protection violation

   Facility: RMS, VMS Record Management Services

   Explanation: One of the following has occurred:

   o  Your process does not have one or more of the privileges
      necessary to perform the requested file access

   o  Your process is denied access to the file because of the
      protection applied to the file or to the directory in which
      the file is listed

   User Action: Verify the protection applied to the file (using the
   DIRECTORY/FULL command), and change the protection if necessary
   (using the SET PROTECTION command). If you cannot change the
   protection, ask the system manager or the owner of the file to
   change it.

   If the file's current protection should permit the desired access,
   verify the protection applied to the directory in which the file
   is listed.

   If the preceding actions do not apply or fail to solve the
   problem, ask the system manager for the necessary privileges.

PRVNOTFND

invalid privilege name

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You specified an invalid privilege name.

   User Action: See the VMS Authorize Utility Manual for information
   on valid privilege names.

PRVNOTUNQ

privilege name 'name' is not unique

   Facility: INSTALL, Install Utility

   Explanation: You entered an abbreviation for a privilege name that
   is not unique.

   User Action: Specify at least four characters for the privilege
   name and retry.

privilege name not unique

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You did not specify enough characters of a privilege
   name to make it unique.

   User Action: Enter at least the first four characters of a
   privilege name.


PRVVIO

privilege violation

   Facility: NCP, Network Control Program

   Explanation: You do not have the privilege to perform the
   requested function. Privileges are required to perform all NCP
   commands, except for the following: HELP, CLEAR EXECUTOR NODE,
   LOOP EXECUTOR, LOOP LINE, LOOP NODE, SET EXECUTOR NODE, SHOW, and
   TELL. To use the PURGE, DEFINE, and LIST commands, you must have
   system privilege (SYSPRV) or have access to the files with the
   system protection. The remaining NCP commands require the operator
   privilege (OPER).

   User Action: None, unless your system manager gives you the
   required privilege.

PSCALI

psect 'psect-name' alignment ('decimal-number') illegal in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A module specified an illegal alignment for a psect.

   User Action: Submit a Software Performance Report on the
   appropriate language translator.

PSCNXR

transfer address is not in executable, relocatable psect in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The transfer address for a module is not in an
   executable, relocatable psect.

   User Action: Move the transfer address into an executable,
   relocatable psect.

PSECBUFOVF

PSECT context buffer overflow

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The .SAVE_PSECT directive attempted to save a program
   section context when the program section context buffer is filled.
   A maximum of 31 program section contexts can be saved in the
   buffer.

   User Action: Reduce the amount of program section nesting.

PSECBUFUND

PSECT context buffer underflow

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The .RESTORE_PSECT directive attempted to restore a
   program section context when the program section context buffer is
   empty.

   User Action: Ensure that each .RESTORE_PSECT directive corresponds
   to a .SAVE_PSECT directive.

PSECOPCNFL

conflicting PSECT options

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The values specified in a .PSECT directive conflicted
   with each other or were not the same as the values specified in a
   preceding .PSECT directive that specified the same program section
   name.

   User Action: Correct the conflicting values in the .PSECT
   directives.

PSTFULL

process section table is full

   Facility: SYSTEM, VMS System Services

   Explanation: The section table in the process header is full.
   Additional sections cannot be created for this process.

   User Action: Relink the image, forcing fewer image sections, or
   reboot, increasing the SYSGEN parameter PROCSECTCNT.

PTELENVIOL

unexpected page table length violation

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PTRCNT

ACP block count exceeds retrieval pointer size

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PURABO

purge aborted due to errors

   Facility: NCP, Network Control Program

   Explanation: The purge requested by the WITH option of the NCP
   command COPY is aborted. The local node database is not affected.

   User Action: See previous error messages to determine why the
   purge is aborted.

PURGEVER

version numbers not permitted

   Facility: Shared by several facilities

   Explanation: The command does not allow version numbers in a file
   specification.

   User Action: Reenter the command; do not specify a version number
   for the file specification.

PURGWSSCN

purge working set scan error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

PUSSTAOVE

pushdown stack overflow

   Facility: LIB, Library Facility

   Explanation: The image pushdown stack overflowed.

   User Action: Use the debugger to determine whether the procedure
   stack does not contain an excessive number of entries, or if an
   infinite call loop has caused the stack to grow.

PUTERR

put error

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.

put error code of 'xx' on file 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: An error writing the specified file occurred due to
   the error code represented as 'xx'.

   User Action: Correct the error code (represented as 'xx') and
   retry.


PWDINDIC

password found in system dictionary; please choose another string

   Facility: SET PASSWORD Utility

   Explanation: To help enforce the use of secure passwords, VMS does
   not allow you to select words which are contained in the system
   password dictionary. The system password dictionary contains
   approximately 50,000 English words.

   User Action: Choose a new character sequence or use a generated
   password.

PWDINHIS

password found in history list; please choose a new password

   Facility: SET PASSWORD Utility

   Explanation: To help enforce the use of secure passwords, VMS does
   not allow you to reuse a password that you have used in the past.
   VMS maintains a list of your last 100 passwords.

   User Action: Choose a new character sequence or use a generated
   password.

PWDLOCKED

password is locked to prevent change

   Facility: SET, SET Facility

   Explanation: This message is returned by the command line
   interpreter for the DCL command SET PASSWORD. The system manager
   restricted an account from changing its password. Typically, this
   is done for demonstration accounts which may be accessed by a
   large number of users.

   User Action: If the user requires that the account not be
   restricted from changing its password, consult the system manager.

PWDNCH

password not changed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: An error occurred using the random password generator
   to generate an account password.

   User Action: None.

PWDNOL

password not on list; try again

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The password you specified is not one of those
   listed.

   User Action: Select another password and try again.

PWDNOTDIF

new password must be different from current password

   Facility: SET, SET Facility

   Explanation: The new password that you specified is the same as
   the old password.

   User Action: Change the password and reenter the command.

PWDNOTVAL

old password validation error-password unchanged

   Facility: SET, SET Facility

   Explanation: This message is returned by the command line
   interpreter for the DCL command SET PASSWORD. An old password
   validation error is detected. The user is required to enter
   the old password to help protect an unattended process. The old
   password may have been mistyped.

   User Action: Reenter the old password. If the old password has
   been forgotten, consult the system manager.

PWDNOTVER

new password validation error-password unchanged

   Facility: SET, SET Facility

   Explanation: This message is returned by the command line
   interpreter for the DCL command SET PASSWORD. The new password
   was not entered the same way twice. Entering the password twice
   ensures that the password intended by the user is properly
   entered.

   User Action: Repeat the entire sequence correctly.

PWDSYNTAX

illegal password syntax

   Facility: SET, SET Facility

   Explanation: An illegal password is used. Passwords may contain
   from 1 through 31 characters. The valid characters are the
   following:

      A through Z
      a through z
      0 through 9
      $ (dollar sign)
      _ (underscore)

   User Action: Reenter the password, using valid characters.

invalid password syntax

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You entered a password using incorrect syntax.

   User Action: Enter a password using 1-31 alphanumeric characters,
   the dollar sign ($),  or the underscore (_) characters.


PWDWEAK

password is too easy to guess; please choose another string

   Facility: SET PASSWORD Utility

   Explanation: To help enforce the use of secure passwords, VMS does
   not allow you to choose certain passwords that are too easy to
   guess. In addition, your site security administrator may choose to
   further restrict your choice of passwords.

   User Action: Choose a new character sequence or use a generated
   password.

PWF

page number will not fit on title

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The title (on the first header information line)
   extends into the page number field, so that the page number will
   not fit.

   User Action: Reduce the length of the title.

QEMPTY

queue empty

   Facility: Shared by several facilities

   Explanation: If returned from a DR32 support routine call, the
   termination queue is empty but the transfer is still in progress.

   User Action: Continue trying to remove a command packet from
   the termination queue until you are successful or the transfer
   completes.

QFACTIVE

disk quota file is already active

   Facility: SYSTEM, VMS System Services

   Explanation: The quota file is already active.

   User Action: Check the device specified and proceed.

QFNOTACT

disk quota file is not active

   Facility: SYSTEM, VMS System Services

   Explanation: The quota file is not active.

   User Action: Check the device specified, or check the default
   device. Turn quotas on, if appropriate.

QIOBFOVF

QIO buffer overflow

   Facility: MOM, Maintenance Operation Module

   Explanation: An internal buffer used to obtain network management
   information is sized inadequately. This is a program logic error
   and should be reported.

   User Action: Submit a Software Performance Report (SPR).

QIOERR

internal QIO error

   Facility: REM, Set Host Facility

   Explanation: A system internal error has occurred.

   User Action: Submit a Software Performance Report (SPR).

QST

Quoted string too long: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: A quoted text value contains too many characters.

   User Action: Reduce the number of characters. In some cases,
   only one quoted character is allowed (for example, the .DISPLAY
   ELEMENTS command). In other cases, up to 150 characters are
   allowed (for example, the .REPEAT command).

QUALINV

'class-name-qualifier' qualifier not valid for 'class-name' class

   Facility: MONITOR, Monitor Utility

   Explanation: An attempt is made to combine a class name with a
   qualifier for which it is not valid. Class name qualifiers are
   valid only for a subset of MONITOR classes.

   User Action: Check the valid combinations of class-names and
   class-name qualifiers by entering the DCL command similar to the
   following:

   HELP MONITOR class_name_qualifiers

   Then, reenter the MONITOR request.

QUE_CLOSED

queue closed, jobs not accepted

   Facility: JBC, Job Controller

   Explanation: You attempted to enter or requeue a job to a queue
   that is marked closed. A closed queue cannot accept new jobs, but
   it will continue to process jobs already entered.

   User Action: Put the queue into an open state by using the /OPEN
   qualifier with the SET QUEUE, START/QUEUE, or INITIALIZE/QUEUE
   commands and retry your request.

QUEFORMAT

system job queue file has invalid format

   Facility: JBC, Job Controller

   Explanation: The job controller detected an error in the format of
   the system job queue file. The nature of the queue file corruption
   is such that the job controller is not able to repair the damage
   and continue operation using this queue file.

   User Action: Create a new queue file using the START/QUEUE/MANAGER
   /NEW_VERSION command or delete the existing queue file and create
   a new file using the START/QUEUE/MANAGER command.

QUEisEMP

queue is empty

   Facility: LIB, Library Facility

   Explanation: The queue is empty, and is not modified.

   User Action: None.

QUENOTSTOP

queue must be stopped to perform operation

   Facility: JBC, Job Controller

   Explanation: A queue management operation that requires the queue
   to be in a stopped state was attempted while the queue was in
   another state. Deleting a queue is such an operation.

   User Action: Enter a STOP/QUEUE/RESET command to stop the queue,
   then reenter the original request.

QUERESET

job aborted during execution because queue was reset

   Facility: JBC, Job Controller

   Explanation: The queue is reset with a STOP/RESET command during
   execution of the affected job.

   User Action: Resubmit the job.

QUEUEMPTY

scheduling queue empty

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

QUITTING

editor quitting

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You are exiting the VAXTPU image editing session.
   When you quit an editing session, the edits you made during the
   session are not saved.

   User Action: None.

QUO

error in quoted string

   Facility: RMS, VMS Record Management Services

   Explanation: The quoted foreign file specification string or the
   quoted task specification string of a file specification does not
   have the correct syntax.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary, if necessary, for the correct syntax and reenter the
   file specification.

QUOTAFAIL

failed to activate quota file; volume locked

   Facility: MOUNT, Mount Utility

   Explanation: An error occurred that enabled the volume's quota
   file; the volume is locked against allocation. A subsequent
   message describes the nature of the error.

   User Action: Correct the problem with the quota file. Then
   dismount and remount the volume.

QUOTAFILE

quota file is too small-use DISKQUOTA to rebuild

   Facility: BACKUP, Backup Utility

   Explanation: During a restore or copy operation with the /IMAGE
   qualifier, BACKUP found that the quota file, [000000]QUOTA.SYS;1,
   on the output volume is not large enough.

   User Action: After the restore or copy operation is complete, use
   the REBUILD function of the DISKQUOTA utility to reconstruct the
   quota file.

Quoted string required

   Facility: EDT, EDT Editor

   Explanation: A required quoted string is not supplied for the
   command you entered. The ^ indicates the position of the required
   quoted string.

   User Action: Reenter the command supplying the required quoted
   string.

RAB

invalid RAB or RAB not accessible

   Facility: RMS, VMS Record Management Services

   Explanation: The block identifier field of the record access block
   for a file does not indicate that this is a RAB. Or the RAB is not
   in an area of memory that can be written by the caller. An attempt
   may have been made to perform record operations to a FAB.

   User Action: Verify that the control block referred to is a
   RAB, that the RAB is properly initialized, and that it is not
   inadvertently modified during execution of the program.

RAC

invalid record access mode

   Facility: RMS, VMS Record Management Services

   Explanation: The record access mode (RAC) field of the RAB
   indicates an invalid record access mode. The field must contain
   either SEQ, KEY, or RFA.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RADRMOD

reserved addressing fault at PC 'location', PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An instruction specifies an addressing mode that
   is illegal within the context of its use. This message indicates
   an exception condition and is usually followed by a display of
   the condition arguments, registers, and stack at the time of the
   exception.

   User Action: Examine the PC and virtual address displayed in the
   message to determine the instruction that caused the error.

Range for RESEQUENCE must be contiguous

   Facility: EDT, EDT Editor

   Explanation: The range specification for the EDT command
   RESEQUENCE did not contain contiguous lines.

   User Action: Reenter the command specifying contiguous lines for
   the range.

Range specified by /SEQUENCE would cause duplicate or non-sequential numbers

   Facility: EDT, EDT Editor

   Explanation: You have range specifications in the EDT command
   RESEQUENCE that would cause duplicate or nonsequential numbers.

   User Action: Modify the range specifications and reenter the
   command.

RAT

invalid record attributes

   Facility: RMS, VMS Record Management Services

   Explanation: The record attributes field of the FAB specified for
   a $CREATE or a $OPEN operation contains a value other than BLK,
   CR, FTN, or PRN, or an invalid combination is specified.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RAWFMT

an invalid raw event is seen and ignored

   Facility: EVL, Event Logger

   Explanation: NETACP obtained an invalid unprocessed event. The
   size of the event exceeded the buffer size. This is probably
   caused by a software error.

   User Action: Submit a Software Performance Report (SPR).

RBF

invalid record buffer

   Facility: RMS, VMS Record Management Services

   Explanation: The record buffer address of the RAB specifies an
   area of memory that cannot be correctly accessed by the caller.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RCTUNRSZR

RCT unreadable, output SERIALNUM field set to zero

   Facility: BACKUP, Backup Utility

   Explanation: This message warns the user that the disk's
   Replacement and Caching Table was unreadable. As a result, the
   output volume serial number is set to 0.

   User Action: None.

RDBADDERR

unable to add 'id-name' to RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The identifier name you specified could not be added
   to the rights database file (RIGHTSLIST.DAT). This message should
   be accompanied by a VMS RMS message that identifies the specific
   reason for the error. Most likely, the identifier name already
   exists in the rights database file. Duplicate identifier names are
   not allowed in the rights database file.

   User Action: Correct the condition identified by the RMS message
   and reenter your command. If you want to change the name of an
   identifier in the rights database file, use the AUTHORIZE command
   MODIFY/IDENTIFIER.

RDBADDERRU

unable to add 'id-name' value: '[UIC]' to RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specified identifier name and its corresponding
   user identification code (UIC) could not be added to the rights
   database file (RIGHTSLIST.DAT). This message should be accompanied
   by a VMS RMS message that identifies the specific reason for the
   error. Most likely, the identifier name already exists in the
   rights database file. Duplicate identifier names are not allowed
   in the rights database file.

   This error also occurs if you copy a record in the system user
   authorization file (SYSUAF.DAT) without specifying a new UIC value
   for the copy. By default, an identifier name and corresponding
   UIC value for the new record are written to the rights database
   file (RIGHTSLIST.DAT); if the UIC has not been changed, it will
   conflict with the UIC of the original record, and a 'duplicate
   identifier' error results.

   User Action: Correct the condition identified by the RMS message
   and reenter your command. If you want to change the UIC value
   of an identifier in the rights database file, use the /VALUE
   qualifier with the AUTHORIZE command MODIFY/IDENTIFIER. If you
   copy a record in the system user authorization file, and you
   want an identifier for the new record to be added to the rights
   database file, use the /UIC qualifier with the AUTHORIZE command
   COPY.

RDBADDERRV

unable to add 'id-name' value: 'hex code' to RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specified identifier name and its corresponding
   integer value (expressed as an 8-bit hexadecimal code) could
   not be added to the rights database file (RIGHTSLIST.DAT).
   This message should be accompanied by a VMS RMS message that
   identifies the specific reason for the error. Most likely, the
   identifier name or value already exists in the rights database
   file. Duplicate identifier names or values are not allowed in the
   rights database file.

   User Action: Correct the condition identified by the RMS message
   and reenter your command. If you want to change the value of an
   identifier in the rights database file, use the /VALUE qualifier
   with the AUTHORIZE command MODIFY/IDENTIFIER.

RDBADDMSG

identifier 'id-name' value: 'hex code' added to RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: A general identifier with the specified name and
   value has been added to the rights database file (RIGHTSLIST.DAT).

   User Action: None.

RDBADDMSGU

identifier 'id-name' value: '[UIC]' added to RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: A UIC identifier with the specified name and value
   has been added to the rights database file (RIGHTSLIST.DAT).

   User Action: None.

RDBCREERR

unable to create RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The rights database file, named RIGHTSLIST.DAT, could
   not be created. This message should be accompanied by a VMS RMS
   message that identifies the specific reason for the error. For
   example, you cannot create another rights database file if one
   already exists, unless you first delete or rename the original
   file.

   User Action: Correct the condition identified by the RMS message
   and reenter your command. If you want to create a new rights
   database file, either delete or rename the current one (if you
   have sufficient privilege to do so). Once the current file has
   been deleted or renamed, reenter your command.

RDBDONEMSG

rights database modified

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The rights database file (RIGHTSLIST.DAT) has been
   modified.

   User Action: None.

RDBMDFYERR

unable to modify identifier 'id-name'

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specificied identifier could not be modified.
   This message should be accompanied by a VMS RMS message that
   identifies the specific reason for the error.

   User Action: Correct the condition identified by the RMS message
   and reenter your command.

RDBMDFYERRU

unable to modify identifier '[UIC]'

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specified UIC identifier could not be modified.
   This message should be accompanied by a VMS RMS message that
   identifies the specific reason for the error.

   User Action: Correct the condition identified by the RMS message
   and reenter your command.

RDBMDFYMSG

identifier 'id-name' modified

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The record for the specified identifier in the rights
   database file has been modified according to the AUTHORIZE command
   MODIFY/IDENTIFIER.

   User Action: None.

RDBNOMODS

no modifications made to rights database

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The rights database file (RIGHTSLIST.DAT) is not
   modified.

   User Action: None.

RDBREMERR

unable to remove 'id-name' from RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specified identifier could not be removed from
   the rights database file (RIGHTSLIST.DAT). This message should
   be accompanied by a VMS RMS message that identifies the specific
   reason for the error.

   User Action: Correct the condition identified by the RMS message
   and reenter your command.

RDBREMMSG

identifier 'id-name' value: 'hex code' removed from RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The general identifier with the specified name and
   hexidecimal value has been removed from the rights database file
   (RIGHTSLIST.DAT).

   User Action: None.

RDBREMMSGU

identifier 'id-name' value: '[UIC]' removed from RIGHTSLIST.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The UIC identifier with the specified name and user
   identification code has been removed from the rights database file
   (RIGHTSLIST.DAT).

   User Action: None.

RDDELDATA

read deleted data address mark

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with read operations on
   RX02 disk drives. A sector that has a deleted data address mark is
   successfully read.

   User Action: None.

RDSNONRES

read data substitute page nonresident

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

READABORTED

READ_CHAR, READ_KEY, or READ_LINE built-in was aborted

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The READ_CHAR, READ_KEY, or READ_LINE built-in
   procedure was aborted because the user action required executing
   other VAXTPU code.

   User Action: Return control to VAXTPU in order for the other code
   to execute.

READATTR

error reading attributes for 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to read the file attributes of the specified file. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

READBAD

error reading bad block data on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to read the bad block data recorded on the specified
   volume. The accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

READBLOCK

error reading block 'n' of 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to read the specified block of the specified file. The
   accompanying message provides additional information.

   User Action: Examine the file for corruption and reconstruct as
   necessary.

READBMAP

error reading storage bitmap on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to read the storage bit map file, [000000]BITMAP.SYS;1,
   on the specified volume. The volume cannot be used as a save set
   disk.

   User Action: Reinitialize the volume, or select another volume and
   retry the operation.

READBOOT

error reading boot block, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during
   an attempt to read the bootstrap block from virtual block 1 of
   the index file, [000000]INDEXF.SYS;1, on the specified relative
   volume. The accompanying message provides additional information.

   User Action: Note that the volume probably cannot be used as a
   system volume for a VAX-11 processor model that requires access to
   the bootstrap block during a bootstrap operation.

READCHECK

read error detected during check on volume 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: While rereading a block in order to perform a data
   check operation, the Exchange Utility encountered an input error.

   User Action: This message is followed by a second message giving
   more specific information about the error discovered by the I/O
   system. Take corrective action based on the additional message.

READCHECKREC

read check error recovered on volume 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an error while
   checking a read on the volume, but the operation succeeded on
   a retry.

   User Action: The file is read successfully, but the user should
   watch the volume for further signs of deterioration. Discard or
   reformat the volume if errors are frequent.

READDIR

error reading directory 'directory-name'

   Facility: BACKUP, Backup Utility and ANALDISK, Analyze/Disk_
   Structure Utility

   Explanation: Either the Backup Utility or the Verify Utility
   encountered an error during an attempt to read the specified
   directory file. The accompanying message provides additional
   information. The Backup Utility terminates processing of the
   directory.

   User Action: Examine the directory using the DCL command DIRECTORY
   and reconstruct files as necessary.

READERR

error reading 'filename'

   Facility: ACCOUNTING, Accounting Utility

   Explanation: An input file specified cannot be read. This message
   is usually accompanied by a VMS RMS message indicating the reason
   for the failure.

   User Action: Take corrective action based on the associated
   message.

error reading 'filename'

   Facility: SET, SET Facility

   Explanation: An error occurred while attempting to read the
   specified file. An accompanying message explains why the error
   occurred.

   User Action: Correct the problem described in the accompanying
   message, and retry the command.

error reading 'filespec'

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The assembler encountered an I/O error when reading
   an input source or macro library file; filespec is the file
   specification of the file being read.

   User Action: Retry the assembly, or create a new copy of the input
   file and then retry the assembly.

error reading 'filespec'

   Facility: Shared by several facilities

   Explanation: An input file specified cannot be read. This message
   is usually accompanied by a VMS RMS message indicating the reason
   for the failure.

   User Action: Take corrective action based on the associated
   message.

error reading 'input-filespec'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An input file cannot be read. This message should
   be accompanied by a VMS RMS message indicating the reason for the
   failure.

   User Action: Follow the recovery procedure for the specified VMS
   RMS message.

I/O error reading boot file

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: A hardware error occurred on the satellite system
   disk.

   User Action: Check the error log for the disk. Either run
   diagnostics on it or call DIGITAL field service.






READERRREC

read error recovered on volume 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an error while
   reading the volume, but the operation succeeded on a retry.

   User Action: The file is read successfully, but the user should
   watch the volume for further signs of deterioration. Discard or
   reformat the volume if errors are frequent.

READERRS

excessive error rate reading 'save-set-spec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered numerous read errors
   in the specified save set. The save set medium is probably
   unusable.

   User Action: Retire the save set medium.

READEVT

error reading processed event record

   Facility: EVL, Event Logger

   Explanation: An error occurred while the event receiver is reading
   incoming event records. As a result, an event is discarded.

   User Action: Submit a Software Performance Report (SPR).

READFILE

file ('file-id') 'filename' error reading VBN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to read the specified virtual block of the specified file
   while executing the /READ_CHECK function. The accompanying message
   provides additional information.

   User Action: Reconstruct the file from back-up media if necessary.

READHEADER

error reading file header for 'filename'

   Facility: DUMP, File Dump Utility

   Explanation: The File Dump Utility encountered an error during
   an attempt to read the file header for the specified file. The
   accompanying message provides additional information. The File
   Dump Utility does not display the file header.

   User Action: Correct the condition that caused the error and
   reenter the command.

file ('file-id') 'filename' file header read error

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to read the specified file header from the index file,
   [000000]INDEXF.SYS;1, on the specified relative volume. The
   accompanying message provides additional information.

   User Action: If the specified file header is currently in use, the
   file can no longer be accessed by the operating system and must
   be reconstructed from back-up media. If the file header is not in
   use, no action is necessary because the operating system will not
   attempt to use it.


READHOME

error reading home block, VBN 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to read the home block from the specified virtual block of
   the index file, [000000]INDEXF.SYS;1, on the specified relative
   volume. The accompanying message provides additional information.

   User Action: The volume probably can be mounted by the operating
   system using one of the alternate home blocks. If the error
   persists, the user should consider copying the volume to fresh
   media. If the /REPAIR qualifier is specified, it is possible that
   the read error will be cleared when the Verify Utility rewrites
   the block.

READIMAP

error reading index file bitmap on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to read the index file, [000000]INDEXF.SYS;1, on the
   specified volume. The volume cannot be used as a save set disk.

   User Action: Reinitialize the volume, or select another volume and
   retry the operation.

READIBMAP

error reading index file bitmap, VBN 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to read the index file bitmap from the specified virtual
   block of the index file, [000000]INDEXF.SYS;1, on the specified
   relative volume. The accompanying message provides additional
   information.

   User Action: The volume probably can be mounted by the operating
   system. However, if the error persists, copy the volume to fresh
   media or reconstruct the volume from backup media. If _/REPAIR
   is specified, the Verify Utility rewrites the specified virtual
   block. This may clear the error. If the error cannot be cleared,
   rewrite the volume.

READJNLACE

error reading journal ACE for 'filespec' file ID 'file-id'

   Facility: BACKUP, Backup Utility

   Explanation: BACKUP could not read the journal Access Control
   Entry for the specified file.

   User Action: Determine if the ACL could not be written. This could
   be due to a corrupted ACL or some other hardware or software
   related error. Correct the problem, if possible, and retry the
   BACKUP operation.

READQUEHEADER

attempt to read queue header of dscb: 'address'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

READQUOTA

error reading QUOTA.SYS, VBN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to read the specified virtual block of the quota file,
   [000000]QUOTA.SYS;1, on relative Volume 1. The accompanying
   message provides additional information.

   User Action: If necessary, correct the condition that caused the
   error and reenter the Verify Utility command line.

READSBMAP

error reading storage bitmap, VBN 'n' RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to read the storage bit map from the specified virtual
   block of the storage bit map file, [000000]BITMAP.SYS;1, on the
   specified relative volume. The accompanying message provides
   additional information.

   User Action: The volume probably can be mounted by the operating
   system. However, if the error persists, copy the volume to fresh
   media or reconstruct the volume from back-up media. If the /REPAIR
   qualifier is specified, the Verify Utility rewrites the specified
   virtual block. This may clear the error. If the error cannot be
   cleared, rewrite the volume.

READSCB

error reading storage control block, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to read the storage control block from virtual block 1 of
   the storage bit map file, [000000]BITMAP.SYS;1, on the specified
   relative volume. The accompanying message provides additional
   information.

   User Action: The volume probably can be mounted by the operating
   system. However, if the error persists, copy the volume to fresh
   media or reconstruct the volume from back-up media. If the /REPAIR
   qualifier is specified, the Verify Utility rewrites the specified
   virtual block. This may clear the error. If the error cannot be
   cleared, rewrite the volume.

READYREAD

mount volume 'n' on 'device-name' for reading

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility requires that the specified volume
   of an input save set be mounted on the specified device.

   User Action: Mount the volume. If the utility is executing
   as an interactive job, enter YES in response to the prompt on
   SYS$COMMAND. If the utility is executing as a batch job, use the
   DCL command REPLY to signal completion.

READYWRITE

mount volume 'n' on 'device-name' for writing

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility requires that the specified volume
   of an output save set be mounted on the specified device.

   User Action: Note that the Backup Utility will write on the
   volume and mount a suitable volume. If the utility is executing
   as an interactive job, enter YES in response to the prompt on
   SYS$COMMAND. If the utility is executing as a batch job, use the
   DCL command REPLY to signal completion.

READZERO

read of record id 0, dscb: 'address'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

REAJBCMBX

error reading job controller mailbox

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error reading its
   mailbox. The accompanying message provides additional information.

   User Action: Take action based on the accompanying message.

REALLYQUIT

buffer modifications will not be saved, continue quitting (Y or N)?

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message prompts you for confirmation that you
   want to execute the built-in procedure QUIT rather than the built-
   in procedure EXIT. When you execute the QUIT procedure, your
   modifications to the buffer are not saved (written into an output
   file). In other words, your file remains as it is prior to the
   editing session.

   User Action: Respond with NO if you change your mind and wish to
   continue editing. Respond with YES if you want to complete the
   built-in procedure QUIT. You must respond with YES or NO.

REALLYRECOVER

continue recovery (Y or N) ?

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A condition has been detected that might cause a
   journal file inconsistency if you continue. The condition is
   indicated by a warning message displayed prior to this prompt.

   User Action: Do not continue the recovery if your environment is
   different from that of the journaled environment.

REBLDREQ

rebuild not performed; some free spaces unavailable; disk quota
usage stale

   Facility: MOUNT, Mount Utility

   Explanation: A volume has been improperly dismounted (such as
   during a system crash), and subsequently mounted with the
   /NOREBUILD qualifier of the MOUNT command. The error occurs
   because a volume that has been dismounted improperly must be
   rebuilt to recover any caching limits that were enabled on the
   volume when it is dismounted. The rebuild operation restores the
   volume's disk quota information and recovers any preallocated
   free space in the EXTENT cache and any file numbers in the FILE_ID
   cache.

   User Action: Rebuild the volume by entering the DCL command SET
   VOLUME/REBUILD.

REBLDWARN

insufficient number of bad sector files written to 'device-name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: When BAD attempted to rebuild the Manufacturer's
   Detected Bad Sector File (MDBSF) and the Software Detected Bad
   Sector File (SDBSF) on a last track device, it is only successful
   in writing to half of the last track or less. This implies that
   the medium may be unreliable.

   User Action: Service the medium (and or drive) to ascertain the
   reliability and data integrity.

REBOOT

this product requires that the system be rebooted.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product that is just installed requires the
   system to be rebooted to complete the installation.

   User Action: Reboot the system after it shuts down.

REBUILD

volume is improperly dismounted; rebuild in progress

   Facility: MOUNT, Mount Utility

   Explanation: A disk is improperly dismounted and information is
   lost. REBUILD will reconstruct the file structure on the volume.

   User Action: None.

RECGTRBL

record size is greater than block size

   Facility: MOUNT, Mount Utility

   Explanation: The record size specified is greater than the block
   size (specified or defaulted).

   User Action: Specify a smaller record size or a larger block size.

RECISDEL

deleting a record already marked as deleted

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal VAXTPU failure occurred.

   User Action: Submit a Software Performance Report (SPR).

RECLNG

file 'filename' has a record of illegal length ('decimal-number')

   Facility: LINK, Linker Utility

   Explanation: A record in a file is of illegal length.

   User Action: Submit a Software Performance Report on the
   appropriate language translator.

illegal record length

   Facility: LBR, Librarian Subroutine Package

   Explanation: The record length exceeds 512 bytes.

   User Action: Reformat the module.

illegal record length 'nnn' in module 'module-name' in 'library
filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The specified module contains records that exceed the
   maximum record length of 2048 bytes.

   User Action: Correct the record length before inserting the module
   in the library.

Record too big, truncated to 255 characters

   Facility: EDT, EDT Editor

   Explanation: The file you attempted to edit or to include has
   lines longer than 255 characters. EDT deleted all characters
   from position 256 on because EDT's line length is limited to 255
   characters.

   User Action: None.



RECORDANS

auto-answer file will be recorded.

   Facility: VMSINSTAL, Install Procedures

   Explanation: You specified the auto-answer option when you started
   VMSINSTAL. An answer file will be recorded for the product about
   to be installed.

   User Action: Answer the prompts as usual.

RECORDSWL

'device-name' is write protected-backup date recording pass not
executed

   Facility: BACKUP, Backup Utility

   Explanation: The input device is software write locked. The BACKUP
   Utility cannot perform the backup data recording pass.

   User Action: Dismount the input device, remount it as writeable,
   and reenter the BACKUP command.

RECOVER

'product-name' is being installed when the system failed.

   Facility: VMSINSTAL, Install Procedures

   Explanation: The specified product is installed when the system
   failed because of a power failure or other problem.

   User Action: You will receive additional instructions.

RECOVERABORT

recovery aborted by journal file inconsistency. Journal file closed.

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An inconsistency is found between what the journal
   file contained and what the executing procedure expected. The
   inconsistency is explained in the next message. The recovery has
   aborted, and the journal file has closed.

   User Action: VAXTPU has recovered as much as it can from your
   journal file. If the recovered information is sufficient, resume
   editing from this point. Otherwise, correct any inconsistencies
   between the initial terminal state and the terminal state when you
   recover your file with the journal file.

RECOVEREND

recovery complete

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The recovery of a VAXTPU session from a journal file
   has completed successfully.

   User Action: Resume editing as before the interruption.

RECOVERFAIL

recovery terminated abnormally; journal file inconsistency

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The recovery is probably not being performed on
   exactly the same text file as the original VAXTPU session, or
   the keys may have different definitions than those used in the
   original editing session.

   User Action: Try the recovery again on the same type of terminal,
   with the same terminal setup, using the original input file
   and command qualifiers. Enter the DCL command SHOW TERMINAL to
   determine your current terminal characteristics.

RECPRN

'filespec' contained 'nnn' records with invalid PRN fields ('mmm'
prefix 'ppp' postfix)

   Facility: EXCHANGE/NETWORK Command

   Explanation: The specified file contained one or more records with
   invalid printing control fields in the print file control area
   (PRN). The first byte of the control area constitutes a prefix
   area, while the second byte constitutes a postfix area. These
   areas specify the carriage control to be performed before and
   after printing, respectively. A carriage return and a line-feed
   character were substituted for each invalid byte, and the file was
   copied.

   User Action: If the substitution is not acceptable, determine the
   cause of the PRN field error, fix it, and reenter the command.

RECTOBIG

'record-size' byte record too large for MAIL buffer

   Facility: MAIL, Mail Utility

   Explanation: MAIL encountered an oversized record during a read
   operation. The record is in an illegal format.

   User Action: Delete the record.

RECTOOBIG

record too large in 'filename'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility discovered a record which is too
   large for EXCHANGE to handle.

   User Action: The file displayed with the message might be
   corrupted, or it might not be in the record format being used
   by EXCHANGE. Reenter the command using the correct /RECORD_FORMAT
   qualifier.

RECTOOSML

data overflows object record in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

RECTRUNC

record truncated

   Facility: LBR, Librarian Subroutine Package

   Explanation: The buffer supplied in the routine is too small for
   the record.

   User Action: Supply a sufficiently large buffer to contain the
   record.

RECTYP

file 'filename' has a record of illegal type ('decimal-number')

   Facility: LINK, Linker Utility

   Explanation: An illegal object record type is encountered.

   User Action: Submit a Software Performance Report on the
   appropriate language translator.

illegal record type 'type' in module 'module-name' in 'library
filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The specified object module contains an illegal
   record type.

   User Action: Recompile the module and reenter the command string.


RECURLEARN

learn sequence reply halted due to recursion

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The key learn sequence is bound within the learn
   sequence. This causes an infinite loop.

   User Action: Bind the learn sequence to a different key.

REDCACHE

volume mounted with reduced cache size

   Facility: MOUNT, Mount Utility

   Explanation: This informational message occurs when the
   /PROCESSOR=UNIQUE qualifier is used with the MOUNT command and
   insufficient paged pool is available to allocate a file system
   buffer cache using the sizes specified by the ACP_MAPCACHE, ACP_
   DIRCACHE, ACP_HDRCACHE, and ACP_DINDXCACHE SYSGEN parameters.
   Instead, a unique cache with a minimal number of buffers is
   allocated.

   User Action: The usual reason to use the /PROCESSOR=UNIQUE
   qualifier before VMS Version 4.0 is to avoid the problem of file
   system activity on one volume degrading file system performance on
   other volumes. This degradation is caused by the single-threaded
   nature of the file system ACP. In VMS Version 4.0, the procedure-
   based file system XQP provides a higher level of concurrency than
   is previously possible even with multiple ACPs. The /PROCESSOR
   qualifier is retained to allow discrete I/O buffer caches to be
   associated with specific volumes, instead of all volumes sharing
   the same I/O buffer cache, which is the default behavior.

   Therefore, the recommended action is to remove the
   /PROCESSOR=UNIQUE qualifier. However, if you need discrete I/O
   buffer caches, increase the size of the SYSGEN parameter PAGEDYN
   to account for the number of I/O buffers required. Also, increase
   the value of the SYSGEN parameter SYSMWCNT, to avoid increased
   system paging.

REDEFSYM

redefining symbol 'symbol-name' from 'addr1' to 'addr2'

   Facility: PATCH, Patch Utility

   Explanation: A user-defined symbol is changed to a different
   value. This typically occurs when you enter the PATCH command
   DEFINE and specify a symbol currently used in the image file, or
   when PATCH moves a VAX MACRO instruction that contains a label to
   a patch area.

   User Action: None.

REDFLGERR

error reading UETP common event flag cluster

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

REENT

file could not be renamed and recovery failed; file has been lost

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $RENAME operation failed and the attempt
   to recover the file's directory entry also failed. The file has
   become a lost file.

   User Action: Either use the ANALYZE/DISK/REPAIR Utility to recover
   the lost file, or ask your system manager to recover the file.

REENTER

please reenter last line as it is ignored

   Facility: MAIL, Mail Utility

   Explanation: MAIL encountered an illegal escape sequence during a
   send operation. The line containing the illegal escape sequence is
   ignored.

   User Action: Reenter the line without illegal escape sequences.

REENTRANCY

reentrancy detected

   Facility: LIB, Library Facility

   Explanation: This message indicates reentrant invocation of a
   routine.

   User Action: Begin debugging procedures to verify and correct
   the problem. Whenever reentrancy is possible, such as at AST
   level, it is strongly recommended that users take appropriate
   action to ensure that their code executes properly in the event of
   reentrancy.

REF

invalid key-of-reference = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The key-of-reference number specified in a key
   definition XAB is either greater than 254 or not a defined key
   for the file.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

REFCNTNEG

PFN reference count is negative

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an inconsistent condition.
   After all of physical memory is written to a system dump file, the
   system will automatically reboot if the BUGREBOOT system parameter
   is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

REFERENCED

existing references prevent deletion

   Facility: JBC, Job Controller

   Explanation: The specified form or queue cannot be deleted because
   of existing references to the form or queue by other queues or
   jobs.

   User Action: Use the SHOW QUEUE/FULL command to locate all such
   references, remove them, and reenter the DELETE/FORM or DELETE
   /QUEUE command.

REFRESH_NEEDED

screen refresh needed

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This is an internal status message, which indicates
   that the screen needs to be refreshed.

   User Action: None.

REFUSED

you cannot attach to that process

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: Either you have attempted to attach to a process that
   is your own process or that is not part of your process tree. You
   cannot perform the attempted operation.

   User Action: None.

REGOPSYNX

register operand syntax error

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The addressing mode syntax contained an error.

   User Action: Correct the addressing mode syntax.

REGWIDDUP

registration string already associated with a different widget

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The registration string is already associated with a
   different widget.

   User Action: An application is attempting to register multiple
   widgets with the same name. Modify the application to use unique
   names for each registered widget.

REJECT

connect to network object rejected

   Facility: SYSTEM, VMS System Services

   Explanation: A request to connect to an object at a remote node
   failed for one of the following reasons:

   o  The object requested does not exist.

   o  The access control information specified is invalid.

   o  The partner NSP has no resources.

   o  The partner task exited during the connect sequence.

   o  The partner task rejected the connect.

   User Action: Determine which reason caused the failure and try to
   correct the condition.

RELCONCAT

relative file cannot be concatenated

   Facility: Shared by several facilities.

   Explanation: A relative file may not be concatenated with another
   file.

   User Action: Use a program to load the relative file.

RELINK

file 'filename' contains deferred relocation. Relink 'filename' and
all images linked against it

   Facility: LINK, Linker Utility

   Explanation: The specified shareable image file is linked under
   the VMS Version 2.0 or Version 2.1 linker.

   User Action: Relink the specified shareable image.

RELMOVED

the product's release notes have been successfully moved to
SYS$HELP.

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL moved the product's release notes file to
   SYS$HELP.

   User Action: Contact your local DIGITAL sales representative.

REMABO

remote node not defined

   Facility: NCP, Network Control Program

   Explanation: The remote node specified in the NCP command COPY is
   not defined in the local node database. If the /WITH qualifier is
   included in the COPY command, the remote node is not placed in the
   local database.

   User Action: None is required; however, if you have sufficient
   privilege, you may want to add the remote node to the local node
   database.

REMARCEST

remote archive link established ('n' messages lost)

   Facility: AUDSRV, Audit Server

   Explanation: The audit server has established a new remote archive
   file connection and enabled archiving to the remote archive file.
   This message also displays the number of messages lost while the
   remote node was unavailable.

   User Action: None. This is an informational message.

REMARCFAIL

remote archive link failure; archive messages will be lost (status:
'status')

   Facility: AUDSRV, Audit Server

   Explanation: The network link to a remote system audit archive
   file has failed.

   User Action: None. The audit server will re-establish a link to
   the remote node as soon as it becomes available.

REMARCNAVL

remote archive link not available; archive messages will be lost

   Facility: AUDSRV, Audit Server

   Explanation: The audit server could not establish a link to the
   node associated with the system audit archive file. This message
   may be accompanied by further information indicating the exact
   nature of the problem. If no further information is signaled, this
   indicates that the node is not available or not accepting remote
   connections.

   User Action: None. The audit server will establish a link to the
   remote node as soon as it becomes available.

REMARCSTS

remote archive link not available ('n' messages lost)

   Facility: AUDSRV, Audit Server

   Explanation: The audit server is unable to establish a link to
   the node associated with the system audit archive file. This
   message follows the REMARCNAVL or REMARCFAIL error message and
   is broadcast each minute indicating the number of archive messages
   being lost.

   User Action: None. The audit server will establish a link to the
   remote node as soon as it becomes available.

REMDEF

the DEFAULT record may not be removed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You attempted to remove the DEFAULT record.

   User Action: Do not attempt to remove the DEFAULT record.

REMDISABLED

resource monitoring disabled for journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: Resource monitoring has been disabled for the
   specified security audit journal file.

   User Action: None. This is an informational message.

REMENABLED

resource monitoring enabled for journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: Resource monitoring has been enabled for the disk
   volume associated with the specified security audit journal file.

   User Action: None. This is an informational message.

REMNOTENAB

resource monitoring not enabled for journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: The audit server could not perform the requested
   action because resource monitoring was not enabled for the
   specified audit journal.

   User Action: Enable resource monitoring for the specified journal,
   and try again.

REMERR

error removing 'filename'

   Facility: SET, SET Facility

   Explanation: An error occurred while trying to remove the
   specified file. This message is issued with an accompanying
   message.

   User Action: Take corrective action based on the accompanying
   message.

unable to delete record

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.


REMMSG

record removed from SYSUAF.DAT

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is informational.

   User Action: None.

REMOINSF

node name specification or /REMOTE missing from command line

   Facility: PRINT, PRINT Command and SUBMIT, SUBMIT Command

   Explanation: To print or submit a file residing on a remote
   node for processing on that node, the /REMOTE qualifier must be
   included in the PRINT or SUBMIT command and the file specification
   must contain the remote node name. Conversely, to print or submit
   a file without using the network, the /REMOTE qualifier cannot be
   used with the PRINT or SUBMIT command and the file specification
   cannot include a node name.

   User Action: Correct the error and reenter the command.

REMOTE

connection established to remote node 'node-name'

   Facility: REM, Set Host Facility

   Explanation: Connection to the remote system has been established.
   This is an informational message.

   User Action: None.

assignment completed on remote node

   Facility: SYSTEM, VMS System Services

   Explanation: An assignment for a transparent connect on a remote
   node completed successfully.

   User Action: None.

Remote System Conflicts with Known System

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver configuration poller discovered a
   remote system with SCSSYSTEMID or SCSNODE equal to that of another
   system to which a virtual circuit is already open.

   User Action: Shut the new system down as soon as possible.
   Reboot it with a unique SCSYSTEMID and SCSNODE. Do not leave
   the new system up any longer than necessary. If you are running
   a VAXcluster and two systems with conflicting identity are
   polling when any other virtual circuit failure takes place in
   the VAXcluster, then systems in the VAXcluster may crash with a
   CLUEXIT bugcheck.


REMOUVOL

REMOUNT relative volume nn (volume label) on 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: An error has occurred on a magnetic tape requiring
   operator intervention.

   User Action: Perform the required physical actions and use the DCL
   command REPLY to notify the ACO the volume is ready.

REMOVE

file ('file-id') error removing directory entry

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to remove a directory entry referencing the specified
   file identification. The accompanying message provides additional
   information.

   User Action: Correct the condition that caused the error and
   reenter the Verify Utility command line.

REMOVED

'directory-name' removed

   Facility: SET, SET Facility

   Explanation: The requested directory is removed successfully.

   User Action: None.

entry for 'filespec' has been removed

   Facility: INSTALL, Install Utility

   Explanation: The Known File Entry is successfully removed. This is
   an informational message.

   User Action: None.

symbol 'symbol-name' removed from 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This success message is generated by the DCL command
   LIBRARY.

   User Action: None.



REMRSRC

insufficient system resources at remote node

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt is made to initiate a DECnet-VAX logical
   link connection. The remote process encountered a resource
   allocation failure while trying to confirm the logical link.

   User Action: This condition is often temporary. If the condition
   persists after repeated retries, the remote process should be run
   under an account with higher quotas. Refer to the VMS Networking
   Manual for additional information.

REMSYS

the SYSTEM record may not be removed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You attempted to remove the SYSTEM record.

   User Action: Do not attempt to remove the SYSTEM record.

RENAMED

'filespec' renamed to 'filespec'

   Facility: Shared by several facilities

   Explanation: This message is associated with the execution of a
   DCL command RENAME. The name of the first file is changed to the
   name given in the second file specification.

   User Action: None.

RENDEF

the DEFAULT record may not be renamed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You attempted to rename the DEFAULT record.

   User Action: Do not attempt to rename the DEFAULT record.

RENMSG

user record renamed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is informational.

   User Action: None.

RENSYS

the SYSTEM record may not be renamed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You attempted to rename the SYSTEM record.

   User Action: Do not attempt to rename the SYSTEM record.

REPEAT

parameter repeated

   Facility: NCP, Network Control Program

   Explanation: A parameter is repeated in the command. A parameter
   may appear only once in a command.

   User Action: Reenter the command without repeating parameters.

REPLACED

module 'module-name' replaced in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This success message is generated by the DCL command
   LIBRARY.

   User Action: None.

'output-filespec' being replaced

   Facility: Shared by several facilities

   Explanation: An output file is replaced successfully by a new
   version.

   User Action: None.


REPLACEERR

replacement value too large for location

   Facility: PATCH, Patch Utility

   Explanation: When you replaced data with the PATCH utility command
   REPLACE, the new data contained more bytes than the old data.

   User Action: Correct and reenter the command.

REPLACERR

error replacing 'module-name' in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: An error occurred during a module replacement
   operation. Either a VMS RMS error occurred or enough virtual
   memory is not available.

   User Action: Ensure that the new file in the replacement operation
   is not corrupt.

REPLAYFAIL

an inconsistency has been discovered, halting execution

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A learn sequence stopped executing. The sequence of
   keystrokes that is saved is inconsistent with the current actions.
   This is probably because some keys have different definitions now
   than when the learn sequence is created.

   User Action: None is required. However, if you suspect that the
   replay of the learn sequence may have altered parts of your text
   incorrectly, check the text for changes.

REPLAYWARNING

an inconsistency has been discovered, continuing execution

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: During the execution of a learn sequence, an
   inconsistency is discovered between the original actions and
   the current ones. It is possible to continue execution, but the
   results may not be those expected. This is probably because some
   keys have different definitions now than when the learn sequence
   is created.

   User Action: None is required. However, if you suspect that the
   learn sequence did not complete correctly, check the text where
   the learn sequence is replayed.

REQDITEMMISS

required item not in item list for call

   Facility: SMI, System Management Intergator/Server

   Explanation: This message indicates an internal error. An SMI call
   specifies an item list within which an item required for the given
   object and that function is not present.

   User Action: Submit a Software Performance Report showing the
   exact sequence of SYSMAN commands leading to the error.

REQFILMIS

requested file is missing from input file 'filename'

   Facility: MONITOR, Monitor Utility

   Explanation: The data describing the file requested with the
   /FILENAME qualifier did not exist in the input file.

   User Action: Correct the /FILENAME qualifier specification and
   reenter the MONITOR command.

REQKEY

at least one keyword must be specified for type 'type-name'

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a type definition with no keywords.

   User Action: Edit the CLD file so that each DEFINE TYPE command
   includes at least one keyword.

REQPRMABS

required parameter is absent

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You did not enter a required qualifier for a DCL
   command.

   User Action: Refer to the VMS DCL Dictionary for the command and
   reenter it using all the required qualifiers.

REQUEST

service required on queue 'name' for job 'number' user 'name'

   Facility: JBC, Job Controller

   Explanation: In response to the /OPERATOR qualifier of the PRINT
   command, this message is displayed at the operator's terminal.
   This message is followed by the text specified with the /OPERATOR
   qualifier.

   User Action: Take the reqested action and enter a START/QUEUE
   command to restart the queue.

REQARGSMISSING

one or more required arguments missing

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have not specified one or more required arguments
   for this DECwindows call.

   User Action: Specify all required arguments.

REQUIRESDECW

feature requires the VAXTPU DECwindows screen updater

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The requested operator or feature is available only
   using the VAXTPU DECwindows screen updater.

   User Action: Do not use the feature.

REQUIRESTERM

feature requires a terminal

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The requested feature is only available when there is
   a terminal.

   User Action: Do not use the feature or specify /DISPLAY qualifier.

RER

file read error

   Facility: RMS, VMS Record Management Services

   Explanation: Either VMS RMS could not read an input file, or a
   terminal read error occurred.

   User Action: If VMS RMS could not read the input file, the status
   value (STV) field of the RAB contains a system status code that
   provides more information about the condition. Take corrective
   action based on this status code.

   If a terminal read error occurred, reenter the input line.

RESCRASH

resources exhausted; server restarting

   Facility: AUDSRV, Audit Server

   Explanation: The process virtual memory allocated to the audit
   server (used to buffer incoming security alarms) has been
   exhausted. This message indicates that the audit server final
   action mode was set to RESTART and that the audit server process
   is restarting. Buffered security alarms received prior to the
   resource exhaustion condition will be stored in the process dump
   file SYS$SYSROOT:[SYSEXE]AUDIT_SERVER.DMP.

   User Action: None.

RESCRITICAL

security auditing resources exhausted on journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: The free disk space on the disk volume associated
   with the specified audit journal has fallen below the resource
   action threshold. An accompanying RESINFO message will indicate
   the number of free disk blocks and the number of disk blocks
   needed to dismiss the resource warning condition. Because of
   this condition, the audit server will suspend non-critical system
   processes in an attempt to prevent complete exhaustion of the
   associated volume.

   User Action: Log into a privileged account and free up disk space
   on the disk volume associated with the specified audit journal
   file.

RESDISMISS

resource exhaustion condition dismissed on journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: The free disk space on the disk volume associated
   with the specified audit journal has risen above the resource
   warning threshold.

   User Action: None.

RESERR

resource error

   Facility: NCP, Network Control Program

   Explanation: A resource necessary to complete the command, for
   example, the system resource nonpaged pool, is not available.

   User Action: Determine why the resource is not available.

RESET

circuit is reset

   Facility: SYSTEM, VMS System Services

   Explanation: The virtual circuit is reset while this request is
   being processed, or the circuit is in the process of being reset
   when you issued the request.

   User Action: Initialize the circuit and retry the call.

RESETQUE

error resetting queue 'queue-name'

   Facility: JBCUPGRAD, Queue Upgrade Utility

   Explanation: An error occurred during a $SNDJBC system service
   call attempting to reset the queue.

   User Action: The accompanying message gives information about why
   the operation failed. Correct the problem and retry the upgrade.

RESIGNAL

resignal condition to next handler

   Facility: SYSTEM, VMS System Services

   Explanation: A condition handler completed without terminating
   or continuing the image. This message is associated with an exit
   status code used by condition handling routines to indicate that
   the exception dispatcher continued its search for handlers.

   User Action: None, this message is not normally displayed.

RESINFO

resource information: 'n' blocks needed, 'n' blocks available

   Facility: AUDSRV, Audit Server

   Explanation: This message indicates the number of disk blocks
   needed to remove the preceding resource exhaustion condition on
   the volume associated with the specified security audit journal
   file. The number of disk blocks currently available is also given.

   User Action: None. This is an informational message.

RESNOTDISK

resource monitoring ignored for journal 'name'; journal is directed
to an invalid device type

   Facility: AUDSRV, Audit Server

   Explanation: Resource monitoring could not be enabled for the
   specified audit journal because the audit journal is not directed
   to a file-structured disk device.

   User Action: Redirect the audit journal to a file-structured disk
   device.

RESOKAY

free resources available on journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: The free disk space on the disk volume associated
   with the specified audit journal is above all thresholds. An
   accompanying RESINFO message will indicate the number of disk
   blocks free.

   User Action: None.

RESOPCODE

opcode 'xx' is reserved

   Facility: PATCH, Patch Utility, DEBUG, VMS Debugger

   Explanation: You specified an opcode that is reserved for DIGITAL
   use only.

   User Action: None.

Response Queue Remove Failure

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the
   port; after 50 failed attempts, it marks the device off line. This
   error is caused by a failure to obtain access to an interlocked
   queue. Possible sources of the problem are CI hardware failures or
   memory, SBI (11/780), CMI (11/750), or BI (8200, 8300, and 8800)
   contention.

   User Action: Call DIGITAL field service.

RESTART

   Facility: AUDSRV, Audit Server

   Explanation: A forced audit server restart was received by the
   audit server process. The audit server process will restart.
   Buffered security alarms received prior to the restart will
   be stored in the process dump file SYS$SYSROOT:[SYSEXE]AUDIT_
   SERVER.DMP.

   User Action: None. This event results from the server FINAL_ACTION
   setting of RESTART.

RESTARTCOM

job Controller abort/restart action complete, queue manager
restarted

   Facility: JBC, Job Controller

   Explanation: This message is signaled to the console terminal to
   inform the system manager that the job controller has recovered
   from a fatal error condition and has restored the batch/print
   queue environment. Recovery entails having the job controller
   respond to a fatal error by aborting itself, restarting itself in
   the context of a new process, and reopening the system queue file
   (if the /RESTART qualifier was used initially with the START/QUEUE
   /MANAGER command). Look for a "JBC-F-" message preceeding this
   message on the console or an operator's terminal to find out what
   error condition caused the job controller to voluntarily abort and
   restart itself.

   User Action: None.

RESTORE

restoring product save set 'letter' . . .

   Facility: VMSINSTAL, Install Procedures

   Explanation: The Backup Utility is restoring the product save set
   that you specified from the distribution media.

   User Action: None.

RESTOREFAIL

error during RESTORE operation

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An error occurred while VAXTPU is restoring a section
   file. This message should be accompanied by a VMS RMS message
   identifying the reason for the error.

   User Action: Check the directory specification, the file
   protection, or any other item specified in the accompanying VMS
   RMS message to make sure that you are trying to restore a valid
   section file.

RESTRICT

UAF restricts access at this time, please log out immediately

   Facility: JBC, Job Controller

   Explanation: The User Authorization File record for the owner
   of the interactive or batch process does not allow access to the
   system at the current time. A short time after this warning is
   issued, the job controller will delete the process.

   User Action: Close your files and logout immediately.

RESULTOVF

resultant string overflow

   Facility: SYSTEM, VMS System Services

   Explanation: A user buffer specified to receive data from the
   system is not long enough. The system does not truncate the data
   because the loss of data will damage its integrity.

   User Action: Check for a programming error. Verify that character
   string descriptors for output data buffers reflect the correct
   lengths.

RESUME

resuming operation on volume 'n'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility is continuing an operation on the
   specified volume of a save set.

   User Action: None.

system operation resumed; security auditing resources available

   Facility: AUDSRV, Audit Server

   Explanation: Normal system operation has been resumed by the audit
   server process following a resource exhaustion condition.

   User Action: None.


RESUMED

connection resumed. Press Ctrl/'escape character' to quit,

   Facility: REM, Set Host Facility

   Explanation: Connection to the remote system has been resumed.
   This is an informational message. To quit the session, type Ctrl
   /'escape character', and to access DTE command mode, type Ctrl
   /'command character'.

   User Action: None.

RESUMEFAIL

system operation not resumed; resource condition still exists on
journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: The audit server was unable to resume normal system
   activity because the free disk space associated with the specified
   audit journal file is still less than the action threshold.

   User Action: Log into a privileged account and free up disk space
   on the disk volume associated with the specified audit journal.

RESUMEWARN

resource exhaustion condition dismissed (with resources still low)
on journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: The audit server has resumed system activity
   following a resource exhaustion condition, however the free disk
   space associated with the specified audit journal file is still
   less than the warning threshold.

   User Action: Log into a privileged account and free up disk space
   on the disk volume associated with the specified audit journal.

RESWARNING

resource warning condition exists on journal 'name'

   Facility: AUDSRV, Audit Server

   Explanation: The free disk space on the disk volume associated
   with the specified audit journal has fallen below the resource
   warning threshold. An accompanying RESINFO message will indicate
   the number of disk blocks free and the number of disk blocks
   needed to dismiss the resource warning condition.

   User Action: Log into a privileged account and free up disk space
   on the disk volume associated with the specified audit journal
   file.

RETURNED

control returned to process 'process-name'

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This message is output by DCL when you log out of a
   spawned process.

   User Action: None.

REVERSECASE

CASE limits were reversed

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A CASE statement is found with the upper and lower
   label value reversed. A CASE statement must specify the lower
   value first.

   User Action: Reverse the CASE values and recompile your program.

REVOKEERR

unable to revoke identifier 'id-name' from 'user ID '

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specified identifier could not be revoked from
   the specified user.

   User Action: Make sure that the user has been granted the
   identifier you are trying to revoke. Use the AUTHORIZE commands
   SHOW/IDENTIFIER/FULL or LIST/IDENTIFIER/FULL to display an
   identifier and the users who hold it.

REVOKEMSG

identifier 'id-name' revoked from 'user-name'

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The specified identifier has been revoked from the
   specified user. The user no longer has the rights associated with
   the identifier.

   User Action: None.

REWIND

the tape will be rewound to try again.

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL is attempting to restore a product save set
   with the Backup Utility. It could not find the required save set
   on the distribution tape that is mounted. VMSINSTAL will rewind
   the tape in case the save sets were not recorded in order.

   User Action: None. Ignore any accompanying BACKUP messages.

REX

record already exists

   Facility: CONVERT, Convert Utility

   Explanation: You have tried to write a record into a relative file
   cell that already contains a record.

   User Action: Delete the record and try again.

record already exists

   Facility: RMS, VMS Record Management Services

   Explanation: A $PUT operation using random record access mode to
   a relative file specified an existing record in the target record
   cell. The new record is not written.

   User Action: Modify the program, if necessary, to detect and
   respond to the condition. You may want to include the UIF option
   in the ROP parameter for the file.


RFA

invalid record file address (RFA)

   Facility: RMS, VMS Record Management Services

   Explanation: The record file address field of the RAB contains a
   zero value for RFA access in a $GET or $FIND operation.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RFAERR

RMS error using RFA access: RFA = xxxxxx, xxx

   Facility: SEARCH, SEARCH Command

   Explanation: SEARCH received an error from VMS RMS when trying to
   position to the start of a window. This message is accompanied by
   other messages.

   User Action: If the file being searched is on another network
   node, and one of the additional messages is "network operation not
   supported", then retry the command without the /WINDOW qualifier.

   Otherwise, if the error is reproducible, notify your system
   manager to submit a Software Performance Report (SPR). The numbers
   displayed with the error message and the file being searched
   should be included with the Software Performance Report (SPR).

RFAPASTEOF

VBN in map block request past EOF

   Facility: LBR, Librarian Subroutine Package

   Explanation: An unexpected internal consistency check occurred.
   One cause of this problem is insufficient virtual memory when
   creating or compressing a large library. Another cause is a
   corrupt library file.

   User Action: Inform your system manager and submit a Software
   Performance Report (SPR). If you are inserting or replacing a
   large number of modules, you may be successful by performing
   the operation in several pieces. If you are compressing a large
   library, your System Manager may have to increase your PGFLQUO
   and/or increase the SYSGEN parameter VIRTUALPAGECNT.

RFLOC

unable to locate related file

   Facility: FDL, Create/FDL Utility

   Explanation: The file that you specified with the AREA POSITION
   FILE_NAME or FILE_ID attribute cannot be found.

   User Action: Check on the location of the desired file, or else
   specify a different FILE_NAME or FILE_ID.

RFM

invalid record format

   Facility: RMS, VMS Record Management Services

   Explanation: The record format field of the FAB does not contain a
   valid value. The valid values for this field are FIX, STM, STMCR,
   STMLF, VAR, VFC, and UDF.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RHB

invalid record header buffer

   Facility: RMS, VMS Record Management Services

   Explanation: The record header buffer address of the RAB specifies
   an area of memory that cannot be accessed correctly by the caller.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RLF

invalid related NAM block

   Facility: RMS, VMS Record Management Services

   Explanation: The address of the NAM block for a related file is
   nonzero but it does not point to a valid related file NAM block
   with a valid resultant name string. Or, too many related blocks
   have been chained together or the related NAM blocks have been
   chained together.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RLK

target record currently locked by another stream

   Facility: RMS, VMS Record Management Services

   Explanation: The target record is locked by another stream.

   User Action: Modify the program, if necessary, to detect and
   respond to the condition.

RLSTMSG

listing file RIGHTSLIST.LIS complete

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The contents of the rights database file
   (RIGHTSLIST.DAT) have been written to the listing file named
   RIGHTLIST.LIS.

   User Action: None.

RLSSRVERR

error encountered while testing $RELEASE_VP system service

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   testing VMS system services. This error is received in relation to
   a previously displayed error condition or could be the result of a
   more serious VMS problem.

   User Action: Identify the condition causing the problem, correct
   it, and re-run the test. If the error persists, submit a Software
   Performance Report. If no condition can be identified, run
   diagnostics for VAX Vectors or contact Digital customer service.

RMALRDCL

resource manager name has already been declared

   Facility: SYSTEM, VMS System Services

   Explanation: The resource manager name specified has previously
   been declared. This is an error in the user program.

   User Action: Correct the error in the user program.

RMS

record caused RMS severe error

   Facility: CONVERT, Convert Utility

   Explanation: This message will be accompanied by an RMS error
   message that explains the error.

   User Action: Correct the error specified by the RMS error message
   and try again.

RMSBUG

RMS has detected an invalid condition

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

RMSERROR

RMS service error

   Facility: Shared by several facilities

   Explanation: An error is encountered during a VMS RMS operation. A
   subsequent message explains the reason for the error.

   User Action: Retry the operation; refer to the VMS Record
   Management Services Manual for more information.

RMSFILINI

error occurred during RMS file initialization 'filename' on node
'nodename'

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred while the Monitor Utility tried
   to set up the specified file for statistics monitoring. Check the
   accompanying messages for more details.

   User Action: Correct the problem specified with the accompanying
   messages and reenter the MONITOR command.

RMSFILMIS

one or more requested RMS files are missing from input file

   Facility: MONITOR, Monitor Utility

   Explanation: The data describing one or more files requested with
   the /FILENAME qualifier did not exist in the input file.

   User Action: Correct the /FILENAME qualifier specification and
   reenter the MONITOR command.

RMV

ACP remove function failed

   Facility: RMS, VMS Record Management Services

   Explanation: A file could not be removed or renamed correctly.
   This message is associated with a system status code returned from
   a file system ACP QIO request made by RMS.

   User Action: The status value (STV) field of the FAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.

RNAME_ABSENT

Resource Manager name absent from this record

   Facility: LMCP, Log Manager Control Program

   Explanation: The resource manager selected for removal is not in
   the currently displayed record.

   User Action: None.

RNAME_INV

hex Resource Manager name contains non-hex characters

   Facility: LMCP, Log Manager Control Program

   Explanation: The hexadecimal resource manager name contains
   invalid characters or was not preceded by %X.

   User Action: Enter the resource manager name using hexadecimal
   characters.

RNAME_LONG

Resource Manager name too long

   Facility: LMCP, Log Manager Control Program

   Explanation: The name of the resource manager entered exceeds 32
   ASCII or 64 hexadecimal characters.

   User Action: Enter the correct number of characters, up to 32
   ASCII and 64 hexadecimal.

RNAME_ODD

hex Resource Manager name is an odd length

   Facility: LMCP, Log Manager Control Program

   Explanation: The hexadecimal resource manager name entered
   contains an odd number of characters which prevents translation.

   User Action: Enter the correct number of characters, up to 32
   ASCII and 64 hexadecimal.

RNF

record not found

   Facility: RMS, VMS Record Management Services

   Explanation: A requested record could not be located in a $FIND or
   $GET operation on a relative or indexed file. Either the record is
   never written or it has been deleted.

   User Action: Modify the program, if necessary, to detect and
   respond to the condition.

RNL

record not locked

   Facility: RMS, VMS Record Management Services

   Explanation: The record specified for a VMS RMS $FREE or $RELEASE
   operation is not locked.

   User Action: Modify the program, if necessary, to detect and
   respond to the condition.

ROP

invalid record options

   Facility: RMS, VMS Record Management Services

   Explanation: An incorrect record option (ROP) is specified.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

ROPRAND

reserved operand fault at PC 'location', PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: An instruction contains an operand in a format that
   is not acceptable. This message indicates an exception condition
   and is usually followed by a display of the condition arguments,
   registers, and stack at the time of the exception.

   User Action: Check for a programming error. Examine the PC
   and virtual address displayed in the message to determine the
   instruction that caused the error.

utility converted a reserved operand to a valid value

   Facility: SORT, Sort/Merge Utility

   Explanation: SORT/MERGE has detected decimal data that contains an
   invalid sign or digit, or data that contains a floating reserved
   operand. The error is corrected, and processing continues.

   User Action: None.


ROUTREQ

line 'line-number': A ROUTINE clause is only valid when generating
an object file

   Facility: CDU, Command Definition Utility

   Explanation: CDU did not encounter a ROUTINE clause while
   attempting to generate an object file. A ROUTINE clause is
   required for object file generation.

   User Action: Edit the CLD file so that a ROUTINE clause is present
   if object file generation is desired.

RPCERR

an internal interprocess communications error has occurred

   Facility: DEBUG, VMS Debugger

   Explanation: An internal communications error has occurred. The
   reason is given in the message following this message.

   User Action: If the error is reproducible, submit a Software
   Performance Report and, if possible, enclose both a copy of
   the program being debugged and a logged debugging session that
   reproduces the error.

RPL

error detected while reading prolog

   Facility: RMS, VMS Record Management Services

   Explanation: An I/O error occurred during an attempt to read the
   file's prolog.

   User Action: Depending on the operation, the status value
   (STV) field in the FAB or RAB contains a system status code
   that provides additional information about the condition. Take
   corrective action based on this status code.

RPTCNTNABS

repeat count not absolute

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The repeat count in a .REPEAT, .SIGNED_BYTE, or
   .SIGNED_WORD directive contained an undefined symbol or is a
   relative expression.

   User Action: Replace the expression with an absolute expression
   that does not contain any undefined symbols.

RQSTABORT

'request', 'time', request 'number' aborted by operator 'operator-
name'

   Facility: OPCOM, Operator Communication

   Explanation: A request to an operator is denied by the DCL command
   REPLY/ABORT.

   User Action: None.

RQSTCAN

request 'nnn' is canceled

   Facility: OPCOM, Operator Communication

   Explanation: A request to an operator is successfully canceled.

   User Action: None.

RQSTCMPLTE

request 'nnn' complete by operator 'operator-name'

   Facility: OPCOM, Operator Communication

   Explanation: An operator has completed a user's request
   successfully; the dialog between the user and the operator is
   complete. This message indicates success.

   User Action: None.

RQSTDONE

request 'number' is satisfied

   Facility: OPCOM, Operator Communication, MOUNT, Mount Utility

   Explanation: The request completed successfully and is canceled by
   the requestor.

   User Action: None.

RQSTPEND

request 'nnn' pending by operator 'operator-name'

   Facility: OPCOM, Operator Communication

   Explanation: An operator responded to a user's request with the
   DCL command REPLY/PENDING. The operator will respond to the
   request when able to do so. This message is informational. If
   the request must be satisfied immediately, use CTRL/C to interrupt
   the request and send another message.

   User Action: None.

RQSTSTST

request status for request 'number'

   Facility: OPCOM, Operator Communication

   Explanation: This message provides the operator with additional,
   detailed information about the request.

   User Action: None.

RRV

invalid RRV record encountered

   Facility: RMS, VMS Record Management Services

   Explanation: An invalid record reference vector (RRV) record is
   detected. This indicates either a previous failure to update RRV
   records (see RVU error message) or a VMS RMS or system software
   error.

   User Action: Reorganize the file using the CONVERT command. If
   a software error is suspected, collect as much information as
   possible and submit a Software Performance Report (SPR).

RSA

record stream currently active

   Facility: RMS, VMS Record Management Services

   Explanation: An attempt is made to issue a VMS RMS record
   operation to a record stream that has an outstanding request. The
   outstanding operation may be asynchronous; or the failed operation
   was attempted at an AST level, or in an inner access mode.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition. Enter a $WAIT
   request before entering any additional requests.

RSBREFNEG

RSB reference count negative

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

RSBREFNZRO

tried to deallocate RSB with non-zero ref. count

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

RSK

record shorter than primary key

   Facility: CONVERT, Convert Utility

   Explanation: The record does not contain enough data to fill the
   primary key field in the indexed output file.

   User Action: Compare the layout of the input and output records,
   and change one or the other to completely fill the primary key
   field of the output records with data.

RSL

invalid resultant string length

   Facility: RMS, VMS Record Management Services

   Explanation: The VMS RMS NAM block contains an invalid value in
   the resultant string length field for an operation (for example,
   $ENTER, $REMOVE, or $SEARCH) in which this field is a required
   input. This field is generally filled in by a previous $CREATE,
   $OPEN, or $SEARCH operation.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RSLOVF

buffer overflow-specify fewer command elements

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The buffer used by the command interpreter to store a
   command string during parsing has overflowed.

   User Action: Simplify the command.

RS_LSS_AC

RSOFFSET field less than ACOFFSET

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: This message, issued along with the BADHEADER
   message, explains why the specified file header is corrupt. In
   this case, the Reserved Area Offset field of an ODS-2 header
   (FH2$B_RSOFFSET) contains a value less than the Access Control
   List Offset field (FH2$B_ACOFFSET), implying that the Reserved
   Area precedes the Access Control List in the header, which is
   invalid.

   User Action: None. See the BADHEADER message.

RSS

invalid resultant string size

   Facility: RMS, VMS Record Management Services

   Explanation: The resultant string area size does not define a
   buffer large enough to receive the resultant file specification
   string being returned from a VMS RMS operation.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RST

invalid resultant string address

   Facility: RMS, VMS Record Management Services

   Explanation: The resultant string area address in the NAM block
   specifies an address that is in an area of memory that cannot be
   written by the caller.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

RSTERR

error in symbol table

   Facility: DEBUG, VMS Debugger

   Explanation: There is a format error in the symbol table.

   User Action: If the format error is not caused by a user program
   error or a DEPOSIT command, submit a Software Performance Report
   (SPR).

RSV_ERR

cannot have RSV device-set to zero

   Facility: SYSGEN, System Generation Utility

   Explanation: RSV is a reserved device name and cannot be specified
   to SYSGEN CONFIGURE.

   User Action: Do not specify RSV as a device name.

RSZ

invalid record size

   Facility: RMS, VMS Record Management Services

   Explanation: The record size (RSZ) field of the RAB contains an
   invalid value for one of the following reasons:

   o  The record size value is greater than the maximum record size
      specified for the file.

   o  The record size value is not the correct size for fixed length
      records.

   o  The record size value is not large enough to contain the
      primary key for an indexed file.

   o  The record size value is different than the original record
      size of a $UPDATE operation on a sequential file.

   The maximum record size value must be in the range of 1 through
   32,767 for the $PUT and $UPDATE services, and in the range of 1
   through 65,535 for the $WRITE service.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

invalid record size

   Facility: CONVERT, Convert Utility

   Explanation: The record is either too long to fit in the specified
   bucket size (relative and indexed files), or it is longer than 512
   bytes and block spanning is not allowed.

   User Action: Make the bucket size larger or specify block
   spanning.


RT11_BADDIRECT

volume 'volume-name' has invalid RT-11 directory

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility has discovered an error in the
   directory structure on the specified volume.

   User Action: The volume is either not an RT-11 volume, or it is
   seriously corrupted.

RT11_BADFILE

bad block file created to cover bad block 'block'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility has created a file named
   FILE.BAD to cover the listed bad block.

   User Action: The user should watch the volume for further signs
   of deterioration. Discard or reformat the volume if errors are
   frequent.

RT11_BIGBADFILE

directory segment full, file has some good blocks

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility created a larger than necessary
   bad block file because the volume directory is full.

   User Action: The user should watch the volume for further signs
   of deterioration. Discard or reformat the volume if errors are
   frequent. Look at the error message for RT11_OVERFLOW for tips on
   making space available.

RT11_DIRSIZE

volume 'volume-name' has directory showing 'number' blocks on a
'numeric-string' block device

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility discovered a mismatch between
   the size of directory and the size of the device.

   User Action: The volume has an error in structure. EXCHANGE will
   not write to the volume, but it will read the volume. If another
   computer system consistently produces volumes which give this
   error, it should be possible to initialize a volume with EXCHANGE
   and take the EXCHANGE-initialized volume to the other system.
   With the EXCHANGE-initialized volume, you will be able to transfer
   files between the two systems in both directions.

RT11_ERRLOCK

volume will be write-locked to prevent corruption

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility has write-locked a volume
   because of a structure error.

   User Action: EXCHANGE has discovered a structure error, and is
   refusing to write to the volume so that the error will not be
   made worse. It should be possible to read some or all of the files
   on the disk. The Exchange Utility can be used to save all of the
   files on the volume, and then recreate the volume without any
   errors. Look at the command file SYS$UPDATE:CONSCOPY.COM to see
   how VMS uses EXCHANGE to make copies of the console device for
   some VAX processors.

RT11_EXTRA

extra words set to maximum of 119

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility reduced the value on a /EXTRA_
   WORDS qualifier to the maximum allowed.

   User Action: In the future, use a smaller value for extra words.

RT11_NOEND

segment end marker is missing from RT-11 directory

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility discovered that an RT-11
   directory segment did not have a proper entry marking the end
   of the segment.

   User Action: EXCHANGE will assume that the last valid entry in the
   directory is the end, and will allow you to read the volume.

RT11_OVERFLOW

directory is full, unable to add file

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility is unable to add a file to an
   RT-11 directory because there is no space.

   User Action: Directory space can be made available by deleting
   files from the volume. It might also be possible to use the
   EXCHANGE INITIALIZE command and the /SEGMENTS qualifier to
   recreate the volume with more directory segments. See the command
   file SYS$UPDATE:CONSCOPY.COM for an example of how to save a
   volume as a virtual device, reinitialize the volume, and copy
   all the files back to the original volume.

RT11_STBLOCK

file start block-segment header inconsistent

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility discovered a mismatch between a
   stored block number and the value EXCHANGE computed.

   User Action: EXCHANGE will use the stored value as the correct
   value. Note that it is possible that there may be missing space or
   overlapping files on the volume.

RT11_TOOMANYBLK

too many blocks, using maximum allocation of 'xx'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility has reduced the /ALLOCATION
   value to the value shown.

   User Action: /ALLOCATION values cannot be larger than the device
   or 65,535, whichever is smaller.

RT11_TOOMANYSEG

too many segments, reducing to 'xx'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility reduced the value on a /SEGMENTS
   qualifier to the maximum allowed.

   User Action: In the future, use a smaller value for /SEGMENTS.

RT11_UNKENT

entry with unknown format in directory

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility found a directory entry which
   had an unexpected format.

   User Action: EXCHANGE will refuse to write to the volume, but will
   attempt to read the volume and make what sense of the volume that
   it can. See the explanation for the RT11_ERRLOCK for information
   on how to restore the volume.

RTB

'nnn' byte record too large for user's buffer

   Facility: RMS, VMS Record Management Services

   Explanation: A record returned from a $GET operation is too large
   for the user buffer provided. The status value (STV) field of
   the RAB contains the size of the record that is too large; the
   returned record is truncated to the size of the user buffer.

   User Action: Correct the program by providing a larger buffer.

RTL

input record too long: truncated 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: Too many characters were entered on a single input
   line; the excess has been discarded.

   User Action: Divide the record into several smaller ones.

record longer than Maximum Record Length

   Facility: CONVERT, Convert Utility

   Explanation: The record from the input file is longer than the
   maximum record length specified in the output file. This is an
   exception condition; the record will not be written to the output
   file. If the /EXIT qualifier is specified, processing will stop.

   User Action: Specify the /TRUNCATE qualifier.


RTNERROR

unexpected error status from user-written routine

   Facility: SORT, Sort/Merge Utility

   Explanation: A user-written comparison or equal-key routine
   returned an unexpected error status.

   User Action: Correct your comparison or equal-key routine.

RTOUTEOF

end-of-file on output 'filespec', insufficient space on volume

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility ran out of space while copying
   an RT-11 file.

   User Action: RT-11 only supports contiguous files, therefore there
   must be a free space on the volume as large as the file you are
   trying to copy. Use the DIRECTORY/ALL command to see where the
   "unused" areas on the volume are. By deleting unneeded files that
   are adjacent to unused areas, it might be possible to create a
   large enough space. Also, if you use the COPY command to copy a
   file to the same volume, you can move files around and make larger
   free areas.

RTPROTECT

file is protected against modification

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility rejected a command to modify a
   protected file.

   User Action: If the file should be modified, use the EXCHANGE
   RENAME /NOPROTECT command to remove the protection from the file.
   Then reenter the command.

RTS

record too short for fixed record format file

   Facility: CONVERT, Convert Utility

   Explanation: The record in the input file is shorter than the
   fixed-length specified in the output file. This is an exception
   condition; the record will not be written. If the /EXIT qualifier
   is specified, then processing will stop.

   User Action: Specify one of the /PAD qualifier options.

RUCONFLICT

another facility has active recovery units on file

   Facility: SYSTEM, VMS System Services

   Explanation: The file cannot be accessed because another facility
   (such as RMS) has been updating the file using recovery units, and
   the file is potentially in an inconsistent state.

   User Action: If the file must be accessed (such as for BACKUP),
   either the file must be made consistent or, in an emergency, the
   recovery units must be turned off.

   If the file is still accessed by another facility, stopping
   the applications using the facility should return the file to
   a consistent state. For RMS files, closing the file or running
   down the process restores the file to a consistent state and turns
   off recovery units.

   If the file is not accessed by another facility, the recovery
   procedure for the facility that has recovery units on the file
   should be invoked to restore the file to a consistent state. For
   RMS files, typing the file or opening the file with RMS recovers
   the file automatically.

   If the file cannot be restored to a consistent state, or if you
   want to access the file without regard to consistency, use the SET
   FILE command with the /RU_FACILITY and /RU_ACTIVE qualifiers to
   turn off recovery units. For example, if RMS has active recovery
   units on the file EXAMPLE.DAT, and you wish to turn off recovery
   units, enter the following command:

   $ SET FILE EXAMPLE.DAT/RU_FACILITY=RMS/NORU_ACTIVE

RUF

fatal error detected by Recovery Unit Facility

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

RVN1NOTMT

root volume is not mounted

   Facility: MOUNT, Mount Utility

   Explanation: The root volume for the volume set specified in the
   DCL command MOUNT/BIND is not mounted. The root volume must be
   mounted when you add a new volume to an existing volume set.

   User Action: Verify that the root volume is mounted and online; if
   not, mount it and reenter the command. Verify the device names and
   volume labels specified in the command and retry the operation.

RVU

error updating RRV's, some paths to data may be lost

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS failed to update all record reference vectors
   (RRVs) when a $PUT or $UPDATE service caused a bucket split. This
   error is usually caused by a hardware or system software error
   during VMS RMS RRV updating. All records are accessible by primary
   key only. RRV errors may subsequently occur.

   User Action: Reorganize the file with the CONVERT command.

SAMEDEVICE

repeated reference to device 'device'

   Facility: BACKUP, Backup Utility

   Explanation: The specified device appeared more than once in the
   BACKUP command. A device may not appear more than once in either a
   list of input devices or a list of output devices. Also, a device
   may not appear as both an input device and an output device. This
   occurs only in physical or image BACKUP operations when the output
   is not a saveset. The main purpose is to prevent the accidental
   initialization of the input disk to be saved. This situation
   will arise if the output specifier of the BACKUP command did
   not provide a device specification (or the device specification
   is syntactically incorrect) and the input device is the user's
   default device. In this case, the output device would default to
   the current default device (the input device).

   User Action: Check the command line to ensure that the device
   specifications are syntatically correct and that no device appears
   (explicitly or implicitly) more than once. Reenter the BACKUP
   command.

SAMEFILE

files are identical

   Facility: DIFF, DIFFERENCES Command

   Explanation: This success message is returned by the DIFF facility
   if the two files being compared are identical.

   User Action: None.

SAVEAMBIGSYM

saving ambiguous symbol 'symbol-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The named symbol could be either an undefined
   procedure or a variable; its correct usage has not yet been
   determined.

   User Action: Define the named symbol as either a PROCEDURE or a
   VARIABLE and save the section file again.

SAVEERROR

error during SAVE operation

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An error occurred while VAXTPU is saving a section
   file. This message should be accompanied by a VMS RMS message
   identifying the reason for the error.

   User Action: Check the directory specification, the file
   protection, or any other item specified in the accompanying
   VMS RMS message to make sure that you are trying to save a valid
   section file.

SAVEUNDEFPROC

saving undefined procedure 'procedure-name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The named procedure is not defined, but it is saved
   in the section file as an undefined procedure.

   User Action: Define the named procedure and save the section file
   again.

SAVSETCLU

save set disk cluster factor must be 1

   Facility: BACKUP, Backup Utility

   Explanation: The specified volume had a volume cluster factor
   larger than 1. The volume cannot be used as a save set disk.

   User Action: Retry the operation using a properly initialized
   Files-11 Structure Level 2 volume.

SAVSETNAM

save set name must be in first list element

   Facility: BACKUP, Backup Utility

   Explanation: In a save set specifier, the first or only element of
   a list must contain a file name. The following list elements, if
   any, must contain only a device name.

   User Action: Enter the command again, with the save set name in
   the first element of the list.

SBIAERROR

fatal SBIA error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

SCANADVANCE

scanner advanced to 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The scanner advanced so that the compiler could
   continue compiling after the error occurred.

   User Action: None.

SCANDEADPT

scan dead page table error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

SCBRDERR

SCB physical read error halt

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

SCHDWK

failed to schedule wakeup request for process 'process-id'

   Facility: RUN, Run Detached Utility

   Explanation: The $SCHDWK system service could not schedule a
   wakeup call to the created process.

   User Action: Determine error returned by the $SCHDWK system
   service, and act accordingly. Note that the created process will
   not be awakened, so it must be deleted and recreated.

SCRBUFOVF

screen buffer overflow

   Facility: LIB, Library Facility

   Explanation: While buffering is in effect, a call to one of the
   terminal-independent screen procedures created more data than
   would fit in an entire buffer.

   User Action: Increase the size of the buffer specified in a call
   to LIB$PUT_BUFFER.

SCSSYSTEMID

has NOT been set to a nonzero value

   Facility: VAXport, VAXport Driver

   Explanation: The port driver will not attempt to start the port.

   User Action: Modify the SCSSYSTEMID SYSGEN parameter and reboot
   the system. See the appropriate VMS installation guide.

SDBSFFULL

software detected bad sector file is full on 'device-name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: The Bad Block Locator Utility located the SDBSF;
   however, it is already full.

   User Action: Reinvoke the Bad Block Locator Utility without
   specifying any execution context that would cause the utility
   to attempt to keep the SDBSF. For example, the user should specify
   the /EXERCISE=NOKEEP qualifier.

SDBSFRFAIL

failed to read the software detected bad sector file on 'device-
name'

   Facility: BAD, Bad Block Locator Utility

   Explanation: The Bad Block Locator Utility could not locate a
   valid SDBSF.

   User Action: Avoid using any execution context that attempts to
   obtain or preserve the SDBSF. The following qualifiers would cause
   the Bad Block Locator Utility to try to preserve the SDBSF: /BAD_
   BLOCKS, /EXERCISE=KEEP, /OUTPUT/SHOW=BEFORE. Use an execution
   context that causes the Bad Block Locator Utility to recreate the
   SDBSF, for example, /EXERCISE.

Search string cannot be null

   Facility: EDT, EDT Editor

   Explanation: You asked EDT to search for nothing.

   User Action: Reenter the command specifying a search string.

SEARCHFAIL

error searching for 'filename'

   Facility: ACCOUNTING, Accounting Utility

   Explanation: The specified file could not be found. A subsequent
   error message explains why.

   User Action: None.

error searching for 'filespec'

   Facility: Shared by several facilities

   Explanation: The specified file could not be found. A subsequent
   error message explains why.

   User Action: Take corrective action based on the associated
   message.


SECINTFAI

secondary interlock failure in queue

   Facility: LIB, Library Facility

   Explanation: Secondary interlock failed (severe error) retry-cnt
   times in a row. The queue is not modified. This condition can
   occur only when the queue is in memory being shared between two or
   more processors.

   User Action: Wait until the queue is free, then retry the
   operation.

SECOUT

error code of 'xx' parsing journal file

   Facility: PATCH, Patch Utility

   Explanation: A command interpreter callback request failed because
   of the error represented as 'xx'.

   User Action: Correct the error (represented as xx) and retry.

SECREFNEG

section reference count went negative

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

SECTBLFUL

section table (process/global) is full

   Facility: SYSTEM, VMS System Services

   Explanation: The system space allocated to maintain information
   about sections is full; no more sections can be created.

   User Action: If you have created many private sections, you may
   have to delete sections when they are no longer needed. If the
   error occurs while a global section, in particular a system global
   section, is being created, this message may indicate that not
   enough space is allocated at system generation for the section
   tables. Notify the system manager of the deficiency.

SECTRESTORED

'count' procedures, 'count' variables, 'count' keys restored

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The indicated items have been successfully restored
   from a section file.

   User Action: None.

SECTSAVED

'count' procedures, 'count' variables, 'count' keys saved

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The indicated items have been saved in a section
   file.

   User Action: None.

SECTUNDEFPROC

saved 'count' undefined procedures, 'count' ambiguous symbols

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The saved section file contains one or more undefined
   procedures or ambiguous symbols.

   User Action: Define the named procedures and symbols and save the
   section file again.

See command on input line 'linenumber' of page 'pagenumber' of file 'filename'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: This is a standard error message line that specifies
   the location of an error-related command in the input file. This
   message indicates the name of the input file (filename) in which
   the command is located, and the file page number and line number
   where the error occurs.

   User Action: Find and correct the invalid command.

SEG

overlapping segments or segmented key must be string for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: The number of key elements specified by a key
   definition XAB is greater than one, and the key data type is not
   STG. Or, the key segments overlap and prolog 3 is specified.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

Select complete lines only

   Facility: EDT, EDT Editor

   Explanation: You used the SELECT line range specifier with a
   line mode command such as COPY, FILL, MOVE, PRINT, TAB ADJUST,
   or WRITE. However, the select range that is active had at least
   one partial line. The select range must include only complete
   lines when it is used with line mode commands.

   User Action: Reenter the command specifying a select range that
   includes complete lines.

Select range is already active

   Facility: EDT, EDT Editor

   Explanation: You attempted to establish a select range when one is
   already in effect.

   User Action: None.

SELRANGEZERO

select range has 0 length

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The range you selected for the built-in procedure
   SELECT_RANGE has a length of 0; therefore, no characters were
   selected.

   User Action: None.

SEMALRMAX

semaphore is already at its maximum value

   Facility: PPL, Parallel Processing Facility

   Explanation: The semaphore value cannot be incremented further.

   User Action: Recode the program to ensure that only the correct
   maximum number of PPL$INCREMENT_SEMAPHORE requests are entered.

SEMANTICS

inconsistent usage of RMS Semantics

   Facility: RMS, VMS Record Management Services

   Explanation: RMS XABITM item codes for stored semantics or access
   semantics have been used in an inconsistent manner.

   User Action: This message indicates a coding error. Check the
   documentation on the use of RMS semantics and verify that the
   application is correctly calling RMS.

SEMININON

semaphore initial value must be non negative

   Facility: PPL, Parallel Processing Facility

   Explanation: An improper initial value is specified.

   User Action: Recode your program to ensure that the correct value
   is passed.

SENDABORT

no message sent

   Facility: MAIL, Mail Utility

   Explanation: You pressed CTRL/C while sending a mail message.

   User Action: None.

SENDERR

error sending to user 'user-name'

   Facility: MAIL, Mail Utility

   Explanation: An error occurred when you attempted to send mail
   to the specified user. This message is usually accompanied by a
   system error message indicating the reason for the failure.

   User Action: None.

SENDFAIL

unable to send to subprocess

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The operation to write to the mailbox for the
   subprocess's input failed.

   User Action: Recreate the subprocess.

SEQ

primary key out of sequence (SEQ access)

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $PUT service specified sequential access,
   but the primary key value of the record is less than the previous
   record entered. $PUT operations in sequential access mode must be
   in ascending order of primary key value.

   User Action: Modify the program, if necessary, to detect and
   respond to the condition. Correct the program and use the $PUT
   system service to put records in ascending order of the primary
   key value.

record not in order

   Facility: CONVERT, Convert Utility

   Explanation: You have specified /NOSORT, but the primary keys are
   not in ascending order.

   User Action: Specify /SORT, or specify /NOFAST.


SEQNCE

illegal record sequence in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A module contained an illegal sequence of object
   records.

   User Action: Submit a Software Performance Report on the
   appropriate language translator.

illegal record sequence in module 'module-name' in 'library
filespec'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The object module you want to insert is illegally
   formatted.

   User Action: Recompile the object module before inserting it into
   the library.


SEQUENCE

illegal record sequence in module 'module'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

Sequence increment must be less than 65,536

   Facility: EDT, EDT Editor

   Explanation: You specified a number as the :increment specifier
   for the /SEQUENCE qualifier that is too large.

   User Action: Reenter the command specifying a smaller number.

Sequence number must be less than 65,536

   Facility: EDT, EDT Editor

   Explanation: You specified a number as the :integer specifier for
   the /SEQUENCE qualifier that is too large.

   User Action: Reenter the command specifying a smaller number.

SEQUENCE2

illegal record sequence

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable image you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

SERVE_ERR

error serving device DDcnn: R0 status = nnnnnnnn

   Facility: STACONFIG, Stand-alone Configure Process

   Explanation: A newly discovered device that fits all the serving
   parameters could not be served. If the value in the R0 status
   is 00000084, the device was not served because the server is not
   loaded.

   User Action: Check to see that the MSCP server has been loaded
   properly. Use the SHOW DEV/SERVED command or examine SCS$GL_MSCP.
   This global address should be a valid system space address. If the
   R0 status is other than 84, get the corresponding message (using
   EXIT nn) and find out what is wrong with the device.

SERVEREXIT

requested audit server shutdown

   Facility: AUDSRV, Audit Server

   Explanation: The audit server has been shut down.

   User Action: None. This is an informational message.

SERVEXISTS

service name already exists

   Facility: LATCP, LAT Control Program

   Explanation: You attempted to create a service already created for
   this node.

   User Action: Use the SHOW CHARACTERISTICS command to see the
   services on your node. Reenter the CREATE command with a new
   service name.

SETIMR

error setting timer

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error setting
   a timer for a job submitted with the /AFTER qualifier. The
   accompanying message provides additional information.

   User Action: Take action based on the accompanying message.

SETKEY

keypad state has been set to 'state'

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified keypad state is set.

   User Action: None.

SETLIMIT

too many volumes on volume set

   Facility: MOUNT, Mount Utility

   Explanation: The maximum permissible number of volumes in a volume
   set (255) has been reached.

   User Action: Find the other volumes in the set and use them first.

SETMAX

value set to maximum for parameter 'name'

   Facility: SYSGEN, System Generation Utility and SYSBOOT, System
   Bootstrap Facility

   Explanation: The value entered in a SET command exceeds the
   maximum allowed.

   User Action: Verify the intended number.

SETMIN

value set to minimum for parameter 'name'

   Facility: SYSGEN, System Generation Utility and SYSBOOT, System
   Bootstrap Facility

   Explanation: The value entered in a SET command is less than the
   minimum allowed.

   User Action: Verify the intended number.

SEVINVALD

illegal severity value

   Facility: SMI, System Management Intergator/Server

   Explanation: An attempt was made to add an entry in the system
   loadable images database with an invalid value for the "severity"
   parameter.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error.

SHARCONF

the /SHARED qualifier conflicts with facility number

   Facility: MESSAGE, Message Utility

   Explanation: You have specified the /SHARED qualifier on the
   facility definition with a facility number other than zero.

   User Action: Remove the /SHARED qualifier from the facility
   definition.

SHMGSNOTMAP

shared memory global section not mapped during creation

   Facility: SYSTEM, VMS System Services

   Explanation: A shared memory global section creation request did
   not specify a virtual address range into which the section is to
   be mapped. The section cannot be initialized unless it is mapped.

   User Action: Specify an input address range to map the section.
   Set RELPAG to zero.

SHMNOTCNCT

shared memory not connected

   Facility: SYSTEM, VMS System Services

   Explanation: The shared memory specified, that is, that part of
   the name to the left of the colon(:), is not connected to this
   processor.

   This error also occurs when colons are inadvertently placed in
   common event flag cluster, mailbox, or global section names.

   User Action: Connect the shared memory.

SHOFIL

unable to open output for SHOW or LIST

   Facility: NCP, Network Control Program

   Explanation: VMS RMS returned an error when attempting to open the
   output file for either a SHOW or LIST command. The VMS RMS error
   code describes the error condition.

   User Action: Take corrective action based on the accompanying VMS
   RMS message.

SHOIO

error writing output file for SHOW or LIST

   Facility: NCP, Network Control Program

   Explanation: RMS returned an error when attempting to write to the
   output file for either a SHOW or LIST command. The RMS error code
   describes the error condition.

   User Action: Take corrective action based on the accompanying
   message.

SHORTBLOCK

save set block is too short

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered a physical block
   shorter than the value recorded for the save set. Data in the
   save set is corrupted.

   User Action: None. Save set data has been lost.

SHORTDUMP

the dump only contains 'm' out of 'n' pages of physical memory

   Facility: SDA, System Dump Analyzer

   Explanation: This message occurs if the system dump file is not
   large enough to accommodate all of physical memory. The number of
   physical pages SDA can analyze is represented by 'm'.

   User Action: Refer to the VMS System Dump Analyzer Utility Manual
   for information on changing the size of the system dump file.

SHOW_ERR

error during show

   Facility: AUTHORIZE, Authorize Utility

   Explanation: This message is issued with other messages.

   User Action: Take corrective action based on the accompanying
   messages.

SHOWERR

SHOW command error

   Facility: MONITOR, Monitor Utility

   Explanation: An error occurred during execution of the SHOW
   command of the Monitor Utility. More information may be obtained
   by examining the accompanying message.

   User Action: Correct the error indicated by the accompanying
   message and rerun the SHOW command. Most such messages represent
   status values returned to MONITOR from the Run-Time Library Screen
   Management Procedures.

unable to complete show command

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The AUTHORIZE command SHOW could not be completed.
   This message should be accompanied by a VMS RMS message that
   identifies the specific reason for the error.

   User Action: Correct the condition identified by the RMS message
   and reenter your command.


SHR

invalid file sharing (SHR) options

   Facility: RMS, VMS Record Management Services

   Explanation: The file sharing field of the FAB contains an invalid
   value for the file organization and the specified access.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

SHRCNTNEG

PFN share count negative

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

SHRCPYIGN

COPY value for /SHARE qualifier ignored, using NOCOPY

   Facility: LINK, Linker Utility

   Explanation: The /SHARE=COPY qualifier may no longer be specified
   in order to obtain an image-private copy of a shareable image.

   User Action: None.

SHRIDMISMAT

ident mismatch with shareable image

   Facility: SYSTEM, VMS System Services

   Explanation: The global section match found in a shareable
   image does not correspond with the global section match in the
   executable image.

   User Action: Relink the executable image.

SHRINSYS

shareable images cannot be linked into a system image

   Facility: LINK, Linker Utility

   Explanation: An attempt is made to link a shareable image with a
   system image.

   User Action: Do not link a shareable image with a system image.

SHRPSCLNG

Psect 'string' has length 'number' in module 'module name' file
'file name' which exceeds length 'number' in shareable image 'image
name'

   Facility: LINK, Linker Utility

   Explanation: In a linking operation that produces an executable
   image including a shareable image as input, the linker now issues
   an error message when an input-object module defines a COMMON area
   to have a greater length than the COMMON area of the same name
   defined in the input shareable image. Previously, the linker did
   not check multiple definitions of the same COMMON area for length
   descrepancies.

   User Action: Modify the length of the program section defining
   COMMON area (such as those used in VAX BASIC, VAX PL/I, VAX
   FORTRAN, and VAX C) to be less than or equal to the length of
   that program section in the shareable image.

SHRPSCREF

reference to psect 'psect-name' is not position-independent in psect
'psect-name' offset 'number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A reference to a psect in a shareable image is made
   without the use of .ADDRESS or general addressing mode.

   User Action: Correct the reference and relink.

SHRSEPCLU

shareable image being placed in separate cluster

   Facility: LINK, Linker Utility

   Explanation: A shareable image is put in a cluster with one or
   more object modules using the CLUSTER= option.

   User Action: Modify the CLUSTER= option so that it specifies
   either a single shareable image or one or more object modules.

SHRSYMREF

reference to symbol 'symbol-name' is not position-independent in
psect 'psect-name' offset 'number' in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: A reference to a symbol in a shareable image is made
   without the use of general addressing mode.

   User Action: Correct the reference to use general addressing mode.

SHRSYMTRA

attempted .TRANSFER of shareable image symbol 'symbol-name' illegal
in psect 'psect-name' offset 'number' in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: A symbol from another shareable image is specified in
   the .TRANSFER directive.

   User Action: Link with the object modules containing the symbol
   rather than the shareable image.

SHUT

local or remote node no longer accepting connects

   Facility: SYSTEM, VMS System Services

   Explanation: The local or remote node is in a state in which it
   no longer accepts connections. (This is not because of a lack of
   resources.)

   User Action: None. Try again later.

SHUTDOWN

OPCOM shutting down. Requested by operator 'operator-name'

   Facility: OPCOM, Operator Communication

   Explanation: OPCOM is announcing the orderly shutdown of its
   activities.

   User Action: Be aware that OPCOM will not be available to perform
   requests.

SIGNO_ARG

signal with no arguments

   Facility: LIB, Library Facility

   Explanation: A call is made to LIB$SIGNAL or LIB$STOP with no
   arguments; LIB$_SIGNO_ARL is substituted.

   User Action: None.

SIZ

invalid key size for key = 'nnn'

   Facility: RMS, VMS Record Management Services

   Explanation: An invalid key size is specified in a key definition
   XAB. The size is invalid for one of the following reasons:

   o  It is greater than 255.

   o  It is zero for key data type STG, DSTG, COL, or DCOL.

   o  It is greater than 16 for key data type PAC DPAC.

   o  It is other than zero or two for key data types BN2, IN2, DBN2,
      or DIN2.

   o  It is other than zero or four for key data types BN4, IN4,
      DBN4, or DIN4.

   o  It is other than zero or eight for key data types BN8, IN8,
      DBN8, or DIN8.

   User Action: The status value (STV) field of the FAB provides the
   key of reference of the XAB in error. Verify that the call to the
   VMS RMS service is coded correctly.

SIZETRUNC

size field truncated to 32 bits

   Facility: DEBUG, VMS Debugger

   Explanation: The size of the entry in a VAX BLISS-32 field
   specification is larger then 32. The debugger set the entry size
   to 32 and executed the command. This message is informational.

   User Action: None.

SKC

.ENDIF/.ELSE not in same file as .IF/.IFNOT: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You attempted to use associated conditional commands
   in separate files.

   User Action: Put the associated conditional commands in the same
   file.

SKPDAT

image data (records not beginning with "$" ignored)

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command procedure contained lines that were not DCL
   commands (that is, the lines did not begin with dollar signs) or
   an image terminated without reading input data records.

   User Action: Check the command procedure for missing dollar signs
   before commands. Or check for the absence of the command that
   should read the data records.

SLOWRESP

system failed to respond within one-half second

   Facility: SMI, System Management Intergator/Server

   Explanation: A clusterwide CONFIGURATION SET TIME command is
   entered, and one of the cluster members took longer than one-half
   second to respond. The time is set and the operation proceeded
   with the next cluster member.

   User Action: Verify that the time was set within acceptable
   tolerances with a SYSMAN CONFIGURATION SHOW TIME command, and
   reenter the SET TIME command if desired.

SMALLPAGE

terminal size 'number' columns by 'lines' is too small

   Facility: FDL, Edit/FDL Utility

   Explanation: The value for x must be 80 or greater, and the value
   for y must be 24 or greater on video terminals.

   User Action: Set the terminal width to 80 or greater, and set the
   page length to 24 or greater with video terminals; with nonvideo
   terminals, any page length is acceptable.

SOFTRERRS

'n' recoverable media errors occurred reading 'save-set-spec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility successfully recovered from read
   errors in the specified save set the specified number of times by
   rereading the blocks in error.

   User Action: None. However, if the number of errors appears
   excessive, consider retiring the save set medium when convenient.

Software is Closing Virtual Circuit

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver closes the virtual circuit to the
   remote port.

   User Action: Check error log entries for the cause of the virtual
   circuit closure. Faulty transmission or reception on both paths,
   for example, causes this error and may be detected from the one
   or two previous error log entries noting bad paths to this remote
   node.

Software Shutting Down Port

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver attempts to reinitialize the port;
   after 50 failed attempts, it marks the device off line.

   User Action: Check other error log entries for the possible cause
   of the port reinitialization failure.

SOFTWERRS

'n' recoverable media errors occurred writing 'save-set-spec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility recovered successfully from
   uncorrectable write errors in the specified save set the specified
   number of times by rewriting the blocks in error.

   User Action: None. However, if the number of errors appears
   excessive, consider retiring the save set medium when convenient.

SOLCONNECT

error connecting to file SYS$SYSTEM:DNS$DEFAULT_FILE.DAT

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The solicitor attempted to check the configuration
   file for errors, but was unable to connect to the file.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

SOLOPEN

error opening file SYS$SYSTEM:DNS$DEFAULT_FILE.DAT

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The solicitor attempted to check the configuration
   file for errors, but was unable to open the file.

   User Action: A specific VMS error immediately follows the
   error text of this message. Take corrective action based on the
   accompanying VMS error message.

SOLREADLINE

error reading line in file SYS$SYSTEM:DNS$DEFAULT_FILE.DAT

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: Invalid configuration information was found in the
   DNS configuration file.

   User Action: You might need to edit the configuration file
   DNS$DEFAULT_FILE.DAT in SYS$SYSTEM. Make sure that the file
   contains only configuration information for the DNS clerk. You
   can reconfigure the system using the SYS$STARTUP:DNS$CHANGE_DEF_
   FILE.COM command file. After making corrections, you must stop the
   DNS clerk (using SYS$STARTUP:DNS$CLERK_STOP.COM) and restart it
   (using SYS$STARTUP:DNS$CLERK_STARTUP.COM).

SOLTIMEOUT

timed out waiting for DNS$ADVER to read mailbox message from
DNS$SOLICIT_MBX

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS solicit process was unable to communicate
   with the advertiser process. This may happen when the advertiser
   process (DNS$ADVER) is unable to start properly, or has terminated
   abnormally.

   User Action: Make sure the DNS$ADVER process is running. If
   it is not, then restart it using the SYS$STARTUP:DNS$CLERK_
   STARTUP.COM command file. If it is running, then stop it using
   SYS$STARTUP.DNS$CLERK_STOP.COM, and then restart it. If this does
   not work, then call your DIGITAL field service representative.

SOLWAITING

waiting for DNS$ADVER to read mailbox message from DNS$SOLICIT_MBX

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: During the startup phase of the DNS clerk, you
   get this message if your system is heavily loaded. This is an
   informational message indicating that startup has taken longer
   than anticipated, but has not yet failed.

   User Action: None.

SORTALLOCMEM

insufficient virtual memory to sort all LBN entries

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: When the Analyze/Disk_Structure Utility determines
   that blocks have been multiply allocated, it attempts to generate
   a report, sorted by logical block number, of the multiply
   allocated blocks. The sort is performed in-memory and requires
   virtual memory. If the utility fails to allocate the needed
   virtual memory, it displays this error message and produces a
   partially sorted report.

   User Action: If the partially sorted report is not acceptable,
   correct the condition that caused the error and reenter the
   command. You may need to increase the page file quota of the
   account or the SYSGEN parameter VIRTUALPAGECNT.

SOURCELINE

at source line 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This message gives the source line number of the
   error, which occurred during compilation.

   User Action: None.

SPAWNED

process 'process-name' spawned

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This message is output by the DCL command SPAWN when
   it spawns a subprocess.

   User Action: None.

SPCIVC

invalid collating sequence specification at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: The syntax you specified for your collating sequence
   is incorrect.

   User Action: Correct the syntax and reenter your specification.

SPCIVD

invalid data type at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: In your specification file text, you incorrectly
   specified a data type or you specified a data type that is not
   recognized by SORT/MERGE.

   User Action: Correct your specification file text.

SPCIVF

invalid field specification at the line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: You incorrectly specified the text in the /FIELD
   clause in your specification file.

   User Action: Correct your specification file text.

SPCIVI

invalid include or omit specification at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: You incorrectly specified the text in an /OMIT or
   /INCLUDE clause.

   User Action: Correct your specification file text.

SPCIVK

invalid key or data specification at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: You incorrectly specified the text in a /KEY or a
   /DATA clause.

   User Action: Correct your specification file text.

SPCIVP

invalid sort process at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: Two possible explanations exist:

   o  The sort process you specified in your specification file is
      not a record, tag, address, or indexed sort.

   o  You specified a nonrecord sort (tag, address, or index), which
      is invalid if you are not using a random access device, if you
      used the record interface on input, or if you specified your
      own comparison or equal-key routine.

   User Action: Specify the correct sort process for your sort.

SPCIVS

invalid specification at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: You specified an invalid keyword in your
   specification file text.

   User Action: Correct your specification file text.

SPCIVX

invalid condition specification at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: You incorrectly specified the syntax in a /CONDITION
   clause in your specification file.

   User Action: Correct your specification file text.

SPCMIS

invalid merge specification at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: You incorrectly specified a sort process for a merge
   operation.

   User Action: Correct your specification file text.

SPCOVR

overridden specification at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: In combination with specification file instructions,
   you specified either SORT/MERGE qualifiers or callable arguments.
   These qualifiers or arguments override any corresponding entries
   in the specification file text. This message is a warning only and
   will not halt processing.

   User Action: None.

SPCSIS

invalid sort specification at line 'number'

   Facility: SORT, Sort/Merge Utility

   Explanation: You incorrectly requested sequence checking in a sort
   operation.

   User Action: Correct your specification file text.

SPDNOTSET

speed not set

   Facility: REM, Set Host Facility

   Explanation: The selected speed is not supported by the terminal.

   User Action: For specific information on supported speeds consult
   the hardware manual for your terminal. Select a supported speed
   and reenter the command.

SPECDEV

can't add component-contains device name

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: You attempted to add a startup component file that
   specifies a device name in the file specification.

   User Action: Reenter the command without the device specification.

SPECDIR

can't add component-contains directory name

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: You attempted to add a startup component file that
   specifies a directory name in the file specification.

   User Action: Reenter the command without the directory
   specification.

SPECIFY

specify option ('valid-options')

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered a fatal error. You
   must select a recovery action. If the QUIT option is selected, the
   utility will terminate. If the CONTINUE option is selected, the
   utility will ignore the error. If the RESTART option is selected,
   the utility will restart the operation at the beginning of the
   current save set volume.

   User Action: Evaluate the preceding errors and select one of the
   options listed in the message. If the utility is executing as an
   interactive job, enter the option in response to the prompt on
   SYS$COMMAND. If the utility is executing as a batch job, use the
   DCL command REPLY to enter the option.

SPECNODE

can't add component-contains node name

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: You attempted to add a startup component file that
   specifies a node name in the file specification.

   User Action: Reenter the command without the node specification.

SPECWILD

can't add component-contains wildcards

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: You attempted to add a startup component file that
   contains a wildcard character in the file specification.

   User Action: Reenter the command without the wildcard characters.

SPL

spool or submit of command file failed on $CLOSE

   Facility: RMS, VMS Record Management Services

   Explanation: The spool or submit command file option that is
   specified on a $CLOSE operation failed. If the IFI field of the
   FAB is zero, the file is closed successfully.

   User Action: The status value (STV) field of the FAB contains
   a code that provides more information about the condition. Take
   corrective action based on this status code.

SPLACQERR

spin locks of higher rank already owned by CPU

   Facility: SMP, Symmetric Multiprocessing

   Explanation: A processor attempted to acquire a spin lock out of
   order. That is, the current spin lock acquisition is being made
   on a spin lock of lower rank than one that is already held by the
   current processor. The multiprocessor system could deadlock if
   spin locks are allowed to be acquired out of order.

   User Action: Analyze the crash dump, and determine which lock is
   being acquired and which locks are already owned by the acquiring
   processor. Correct your code so the locks are acquired in the
   correct order.

   One probable situation that can occur is when a processor
   acquired a lock many times during a driver's execution, then
   incorrectly executed a conditional release of the lock rather
   than unconditionally releasing it as might have been intended.
   This leaves the spin lock still owned by this processor. If the
   processor subsequently attempts to acquire a lower-ranked spin
   lock while still owning the previous lock, the operating system
   prevents a potential deadlock by issuing this bugcheck. Correct
   the driver code to prevent this, or similar, situations from
   occurring.

   Note that this bugcheck applies only to static spin locks, not to
   device locks. Device locks are not subject to the ranking rules
   that static spin locks (which include fork locks) are subject to.

SPLRELERR

spin lock to be released is not owned

   Facility: SMP, Symmetric Multiprocessing

   Explanation: A processor is attempting to release ownership of a
   spin lock that is not currently owned by that processor.

   User Action: Analyze the crash dump and determine why that spin
   lock wasn't owned when the processor tried to release it. Correct
   the code to eliminate the problem.

   The following situation is one that would cause this bugcheck.
   A processor, while executing a driver, might build up multiple,
   nested acquisitions of this spin lock through calling several
   levels of subroutine, each acquiring ownership of the spin
   lock. If one of the called subroutines incorrectly executes an
   unconditional release of this spin lock, then a caller of that
   subroutine tries to release the spin lock later, believing the
   spin lock to be held. The system checks for bugs because the code
   is trying to release a spin lock that the processor no longer
   owns.

SPLRSTERR

spin lock to be conditionally released is not owned

   Facility: SMP, Symmetric Multiprocessing

   Explanation: A processor is attempting to release a single level
   of ownership (restore) for a spin lock that is not currently owned
   by that processor.

   User Action: Analyze the crash dump and determine why that spin
   lock was not owned when the processor tried to release it. Correct
   the code to eliminate the problem.

   The following situation is one that would cause this bugcheck.
   A processor, while executing a driver, might build up multiple,
   nested acquisitions of this spin lock through calling several
   levels of subroutine, each acquiring ownership of the spin
   lock. If one of the called subroutines incorrectly executes an
   unconditional release of this spin lock, then a caller of that
   subroutine will try to release the spin lock later, believing the
   spin lock to be held. The system checks for bugs because the code
   is trying to release a spin lock that the processor no longer
   owns.

SPLIPLHIGH

current IPL exceeds synchronization IPL of desired spin lock

   Facility: SMP, Symmetric Multiprocessing

   Explanation: A processor is attempting to acquire a spin lock from
   an IPL that is higher than the synchronization IPL associated with
   that spin lock.

   User Action: Analyze the crash dump and determine the code
   sequence that is trying to acquire the spin lock from the
   excessively high IPL. It might be, for instance, a case where
   driver code previously raised the IPL to accomplish something
   else, then failed to lower the IPL again prior to acquiring the
   lock that is synchronized by the lower IPL.

   Note that under no circumstances can a driver lower the IPL below
   that level from which it originally raised the IPL, unless it does
   so by creating a fork process.

SPLIPLLOW

IPL has fallen below level of owned spin locks

   Facility: SMP, Symmetric Multiprocessing

   Explanation: A processor is attempting to release a spin lock
   while executing at an IPL that is below the synchronization IPL
   associated with that spin lock, indicating that local processor
   synchronization is compromised.

   User Action: Analyze the crash dump and determine the point where
   your code has lowered the IPL below the level associated with
   the spin lock that is held. Correct the code such that IPL is not
   lowered before the spin lock is released.

SPNAMLNG

PSECT module 'module-name' file 'library filespec' has illegal
length 'nnn'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The PSECT name length exceeds the maximum length of
   31 characters.

   User Action: Change the PSECT name length, recompile the module,
   and reenter the command line.

SPTERRS

errors occurred writing the system page table to the dump file

   Facility: SDA, System Dump Analyzer

   Explanation: The first block of the dump file contains information
   indicating that there were errors while writing the memory
   associated with the system page table to the dump file.

   User Action: None. The dump file is probably not useful for
   analysis.

SPTFULL

system page table is full

   Facility: SYSGEN, System Generation Utility

   Explanation: There is no space available in the system page table
   to allocate a system page for the device (requested by DPT$_MSVP
   in the driver prologue table).

   User Action: Reboot the system, stopping in SYSBOOT, and increase
   the value of the system page table parameter (SPTREQ).

SPTNOTFND

system page table not found in dump file

   Facility: SDA, System Dump Analyzer

   Explanation: The operating system was unable to copy the system
   page table to SYSDUMP.DMP when it failed. As a result, SDA could
   not examine the dump file.

   User Action: None. The system page table is vital to SDA
   initialization.

SPWNIO

shared input or output files are not allowed-respecify

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You used a file that is already opened by DCL as
   input or output to SPAWN.

   User Action: If input or output to DCL is SYS$INPUT or SYS$OUTPUT,
   do not specify the input or output qualifier. See the SPAWN
   command in the VMS DCL Dictionary for details on input and output
   interpretation.

SQO

operation not sequential (SQO set)

   Facility: RMS, VMS Record Management Services

   Explanation: An attempt is made to perform random access to a file
   opened or created with the SQO file processing option; the file
   can be processed only with sequential operations.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

SQUALERR

more than one statistic qualifier specified for 'class-name' class

   Facility: MONITOR, Monitor Utility

   Explanation: The MONITOR request specified more than one of the
   statistic qualifiers (/CURRENT, /AVERAGE, /MINIMUM, /MAXIMUM,
   /ALL) for the indicated class. Only one of these qualifiers may be
   specified per class.

   User Action: Reenter the MONITOR request, specifying only one
   statistic qualifier per class.

SQUROONEG

square root of negative value user PC 'location'

   Facility: MTH, Mathematics Facility

   Explanation: A mathematics library procedure is called to evaluate
   the square root of a negative number. The result returned is the
   reserved operand, minus zero.

   User Action: Locate the call to the library procedure that
   returned the error. Correct your program making the argument zero
   or positive.

SRCLIN

the source input entry is 'string'

   Facility: BAD, Bad Block Locator Utility

   Explanation: This message is associated with the DUPBLKNUM error
   message and displays the portion of the command line that is in
   error. The duplicate block is ignored.

   User Action: None.

SRCLINNOT

source lines not available for module 'path-name'

   Facility: DEBUG, VMS Debugger

   Explanation: The source lines from module 'path-name' cannot be
   displayed or searched because there is no source line information
   in the Debug Symbol Table (DST) for that module. Either the
   compiler is not able to generate such information or the /DEBUG
   qualifier was not used on the compilation or link command.

   User Action: If the language in question supports source line
   display, recompile and relink with the /DEBUG qualifier. If the
   language does not support source line display, source lines will
   not be available to the debugger for modules written in that
   language.

SRCMEM

only source member of shadow set cannot be dismounted

   Facility: DISMOUNT, DISMOUNT Command

   Explanation: An attempt was made to dismount a shadow set member,
   however, that member is the only valid source member of the set.

   User Action: If a shadow set contains only one set member, that
   member cannot be dismounted. To dissolve the shadow set, dimount
   the virtual unit. If there is more than one member and the
   intention is to remove a full member, wait for copy operations
   to complete before dismounting a member.

SRTIWA

insufficient space; specification file is too complex

   Facility: SORT, Sort/Merge Utility

   Explanation: The work area is too small for the number of
   instructions that you have specified in your specification file.

   User Action: Simplify your specification file text by reducing,
   for example, the number of /FIELD clauses.

SRVALLOAD

the MSCP server is already loaded

   Facility: SYSGEN, System Generation Utility

   Explanation: You attempted to load the MSCP server using the MSCP
   command within SYSGEN, and the server is already loaded using the
   SYSGEN parameter MSCP_LOAD. The MSCP server has been loaded the
   recommended way. This warning is printed to remind you that this
   command is obsolete.

   User Action: If this warning is printed because the MSCP command
   is still in a startup command procedure, this command should be
   edited out of the procedure.

SRVMISMATCH

monitor server on remote node is an incompatible version

   Facility: MONITOR, Monitor Utility

   Explanation: You attempted to monitor a node running on an
   incompatible version of the Monitor Utility. This can occur in
   a cluster if all of the nodes are not running the same Version of
   the VMS operating system. This is only a warning and the Monitor
   request will continue to monitor other requested nodes running the
   same version as the node on which the request was initiated.

   User Action: None.

SSCHANGE

unexpected end of save set on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: Internal consistency checks have detected that the
   current save set has ended, and BACKUP is reading a new save set.

   User Action: You will be prompted to continue or quit. If you
   choose the continue option, BACKUP will continue reading the new
   save set.

SSERROR

'service-name' system service error

   Facility: MONITOR, Monitor Utility

   Explanation: The indicated system service returned a failing
   status code. The status code appears as a linked message that
   follows this message.

   User Action: Check the description of the failing status code for
   the indicated system service in the VMS System Services Reference
   Manual. Correct the condition causing the failure, if possible,
   and reenter the MONITOR request. Otherwise, submit a Software
   Performance Report (SPR).

SSFAIL

system service failure exception, status = 'xxxxxxxx', PC =
'location', PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: A call to a system service returned an error or a
   severe error status code. The image has enabled system service
   failure exception mode. This mode allows an image to signal a
   software exception when a failure occurs in a system service call.
   The operating system displays the failure status code, the PC, and
   the PSL at the time of the exception.

   User Action: Examine the PC and virtual address displayed in the
   message to determine the instruction that caused the error.

SSR

restricted character '^\' (octal 34) encountered in text, ignored

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR encountered a restricted character in the input
   file.

   User Action: Remove the restricted character. You cannot use it in
   a DSR input file.

SSRVEXCEPT

unexpected system service exception

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

STABLEEXC

equal-key routine and stable option cannot both be specified

   Facility: SORT, Sort/Merge Utility

   Explanation: You specified both an equal-key routine and the
   SOR$M_STABLE option when only one or the other is allowed.

   User Action: Specify either the equal-key routine or the stable
   option.

STACKDUMP

non-symbolic stack dump follows

   Facility: TRACE, Traceback Facility

   Explanation: This message precedes a traceback dump. The
   accompanying message indicates why the traceback is nonsymbolic.
   This message is informational. The nonsymbolic stack dump is
   displayed following this message.

   User Action: None.

STACKOVER

stack overflow during compilation

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The program is too complex for VAXTPU to parse. The
   program may be written in a language other than VAXTPU.

   User Action: If you are compiling a valid VAXTPU program, please
   submit a Software Performance Report describing the conditions
   that led to the error.

STALITUDF

stack of undefined literal 'number' in record 'number' in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An attempt is made to stack an undefined literal.

   User Action: Submit a Software Performance Report on the
   appropriate language processor.

STARTDELETE

starting file deletion pass

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility is beginning to delete files in
   response to the /DELETE qualifier.

   User Action: None.

STARTED

LAT terminal port driver started

   Facility: LATCP, LAT Control Program

   Explanation: The LAT port driver started successfully. This
   message is informational.

   User Action: None.

queue already started

   Facility: JBC, Job Controller

   Explanation: The queue cannot be started because it is already
   running.

   User Action: None.

Starting memory dump . . . Memory dump complete

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS operating system reached an unrecoverable or
   inconsistent situation and is beginning a bugcheck sequence. If
   the system is configured to take a memory dump, these messages
   accompany the dump. No other messages appear if the SYSGEN
   parameter DUMPSTYLE is set so that a full dump (that is, a dump of
   all of physical memory) is written.

   User Action: None. However, if the situation that caused the
   system to write the memory dump indicates that you should submit
   a Software Performance Report (SPR), a copy of the dump file just
   written should accompany the SPR.

Starting memory dump . . .

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS operating system reached an unrecoverable or
   inconsistent situation and is beginning a bugcheck sequence. If
   the system is configured to take a memory dump, messages similar
   to the following messages might accompany the dump:

      Header and error log buffers dumped . . .
      SPT & GPT dumped . . .
      System space (S0) dumped . . .
      Global pages dumped . . .
      'process-name' dumped . . .
      'process-name' dumped . . .
      **** Memory dump complete . . . .

   These messages give information about the progress of the writing
   of that dump. These messages appear if the SYSGEN parameter
   DUMPSTYLE is set so that a selective dump (that is, a dump of
   selected portions of system space and process address space in
   virtual memory) is written.

   A selective dump is similar to a complete dump when writing the
   dump header and system error log buffers. Following these items,
   it differs from the complete dump by immediately writing out
   the system and global page tables. The page tables and system
   space are the minimum content needed to analyze a crash dump;
   configuring your dump file so that this minimum cannot be dumped
   causes the dump to be useless.

   The global pages written during the dump are written separately
   from the processes that might reference them. This allows a single
   copy of each global page to exist in the dump. Processes are
   selected to have their P0 and P1 spaces dumped in the following
   order: current processes (if any) on the CPU that initiated the
   bugcheck, special system processes, current processes (if any) on
   other CPUs, and any other processes. A message giving the name of
   the process follows the writing of the dump for that process if it
   completed successfully.

   Global and process pages are optional when writing a dump in
   that the dump may still yield useful information if they are not
   present. However, DIGITAL recommends that you use a dump file at
   least as large as the one created by AUTOGEN. If the dump file is
   not large enough to hold all process and page files, the dump is
   still considered to have finished normally.

   User Action: None. However, if the situation that caused the
   VMS operating system to write the memory dump indicates that you
   should submit a Software Performance Report (SPR), a copy of the
   dump file should accompany the SPR.


STARTRECORD

starting backup date recording pass

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility completed a save or copy operation
   and is beginning to update back-up dates in response to the
   /RECORD qualifier.

   User Action: If the /SINCE=BACKUP or /BEFORE=BACKUP qualifiers
   are used, note that data will be lost if you restart the operation
   using the same output medium. If it is necessary to restart the
   operation because of a system failure, use another volume.

STARTVERIFY

starting verification pass

   Facility: BACKUP, Backup Utility

   Explanation: The BACKUP Utility completed the operation on the
   current volume and is beginning to verify data in response to the
   /VERIFY qualifier.

   User Action: None.

STASMALLMEM

small memory system. Booted device must stay online during
operation.

   Facility: BACKUP, Backup Utility

   Explanation: The amount of system memory is too small to lock all
   of standalone BACKUP into the working set.

   User Action: Ensure that the device from which standalone BACKUP
   booted stays online during the entire BACKUP operation.

STATENTSVD

software state not saved during powerfail

   Facility: BUGCHECK, System Bugcheck

   Explanation: Before power is lost, the volatile software state of
   the VAX processor is not completely saved in memory. After all of
   physical memory is written to a system dump file, the system will
   automatically reboot if the BUGREBOOT system parameter is set to
   one.

   User Action: Check all processor mechanisms related to the
   detection of a power failure. Be sure that no peripheral adapter
   recognizes an impending power failure before the processor does
   because, in that case, the processor would be prevented from
   handling the failing power condition.

STATE_UNK

transaction state UNKNOWN: xx (xx)

   Facility: LMCP, Log Manager Control Program

   Explanation: An attempt was made to dump a record that contained
   an unknown transaction state.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error and include a BACKUP
   save set containing the output of the LMCP DUMP command for the
   given log file and the output of the DCL DUMP command for the same
   log file.

STATOOLONG

truncating status line to 'count' characters

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have defined a window status line that is too
   long to fit within the boundaries of the current physical width of
   the terminal. The text has been truncated to fit on the screen.

   User Action: Redefine the status line to a shorter line of text.

STD

too many nested .NOTEs and/or .LISTs: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You attempted to nest more than 20 notes or 20 lists
   (or more than 7 within a footnote).

   User Action: Reduce the number of nested notes or lists.

STDISPIC

illegal non-relocatable displacement value in psect 'name' offset
'offset'

   Facility: LINK, Linker Utility

   Explanation: The linker encountered a nonrelocatable reference
   while linking what is intended to be a position-independent
   shareable image.

   User Action: Find the reference using the information in the
   message, and make the reference relocatable.

STEPINTO

cannot step over PC = 'address-value'

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger was unable to step over the routine
   and executed a step into the routine instead. This message is
   informational.

   User Action: None.

STGTRUNC

string truncated

   Facility: PATCH, Patch Utility and DEBUG, VMS Debugger

   Explanation: The Patch Utility truncated an ASCII string entry
   because it exceeded the current length mode or because the entry
   is inappropriate for the context in which it is specified. Or the
   debugger truncated an ASCII string because it exceeded the size of
   the ASCII data type.

   User Action: If the Patch Utility generated this message, correct
   the ASCII string and retry. If the debugger generated this
   message, no action is required.

STILLKEYS

keys still point at data

   Facility: LBR, Librarian Subroutine Package

   Explanation: This warning message is generated by the Librarian
   routines. Keys in other indexes still point to the text. The call
   to LBR$DELETE_DATA did not delete the text.

   User Action: None. Processing continues.

STKOVF

command procedures too deeply nested-limit to 32 levels

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The maximum level of nesting of command procedures is
   exceeded. Too many procedures invoked other procedures.

   User Action: Simplify the command procedure hierarchy to reduce
   the level of nesting.

STKOVFLO

stack of 'number' pages falls below control region to 'address'

   Facility: LINK, Linker Utility

   Explanation: The memory allocation for P1 space does not allow
   enough room for the stack.

   User Action: Correct the allocation to allow enough room for the
   stack.

STMRECFMT

illegal stream record format in 'record'

   Facility: EXCHANGE, Exchange Utility

   Explanation: While processing a file with /RECORD_FORMAT=STREAM,
   the EXCHANGE utility found an invalid record.

   User Action: The input file might contain a record too large for
   an output stream file, or an input file is not a valid stream
   file. Use the correct /RECORD_FORMAT type for the file.

STNOTAVAIL

requested starting block number is not available

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility could not satisfy a /START_BLOCK
   request.

   User Action: Either the requested block is already contained
   inside a file, or it is larger than the largest block on the
   volume. Use the EXCHANGE DIRECTORY /FULL /ALL to discover the
   location and sizes of unused areas on the volume.

STOPPED

LAT terminal port driver stopped

   Facility: LATCP, LAT Control Program

   Explanation: The LAT port driver stopped successfully. This is an
   informational message.

   User Action: None.

STPCLU

component file is cluster-wide

   Facility: SYSMAN, Cluster System Management Utility

   Explanation: A SYSMAN STARTUP command is entered with the
   environment set with the /CLUSTER qualifier. The /CLUSTER
   qualifier is ignored.

   User Action: None.

STPINVALD

illegal load step value

   Facility: SMI, System Management Intergator/Server

   Explanation: An attempt was made to add an entry in the system
   loadable images database with an invalid value for the "load step"
   parameter.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error.

STRCPYERR

unexpected error from string copy routine

   Facility: DIFF, DIFFERENCES Command

   Explanation: An unexpected error occurred during an RTL string
   copy operation.

   User Action: Submit a Software Performance Report (SPR).

String delimiter must be nonalphanumeric

   Facility: EDT, EDT Editor

   Explanation: You used a letter, digit, or percent sign (%)  as a
   string delimiter.

   User Action: Reenter the command using a valid string delimiter.

String is not found

   Facility: EDT, EDT Editor

   Explanation: The string defined in the range specification cannot
   be found.

   User Action: Verify that EDT is searching in the expected
   direction and that you typed the string correctly.

STRIS_INT

string is interlocked

   Facility: LIB, Library Facility, OTS, General Purpose Facility,
   STR, String Manipulation Facility

   Explanation: Code being executed at AST level attempted writing
   into a string that is being written into or whose length is being
   used for length computation immediately before the AST.

   User Action: Do not write to strings at AST level that are used at
   non-AST level or in other AST-level processing. If it is necessary
   to use the same strings for interrupt routines, then disable ASTs
   while string assignments are in progress.

STRLVL

illegal object language structure level ('decimal-number') should be
'decimal-number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module header record specified an illegal
   object language structure level.

   User Action: Submit a Software Performance Report on the
   appropriate language processor.

illegal object language structure level in module 'module-name'

   Facility: LIB, Library Facility

   Explanation: The Run-Time Library encountered severe format errors
   in the shareable you are trying to call.

   User Action: Enter the ANALYZE/IMAGE command specifying the image
   in question. If the errors indicate an operating system internal
   error, submit a Software Performance Report (SPR).

object structure level 'nnn' unsupported in module 'module-name' in
'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: This error message is generated by the DCL command
   LIBRARY. An illegally formatted object file is inserted.

   User Action: Recompile the object file and insert it into the
   library.



STRNGPAD

string operand lengths do not match, shorter zero extended on right

   Facility: DEBUG, VMS Debugger

   Explanation: The operands of a string comparison ( 'ABC' < 'AB' )
   did not have the same length. The shorter one is zero-extended on
   the right.

   User Action: Use strings of the same length.

STRNOTFOUND

string not found

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A search for a simple string or a pattern failed.

   User Action: None.

STRNOTWCB

data structure not window block

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

STRTERESC

illegal escape sequence embedded in string

   Facility: DTK, DECtalk Facility

   Explanation: A DTK$ output routine passed an escape sequence
   embedded in the output string.

   User Action: Check your output string to determine which escape
   sequence is being passed. If you need this escape sequence, most
   likely a DTK$ routine has already been defined that provides that
   feature.

illegal escape sequence embedded in strings

   Facility: SMG, Screen Management Facility

   Explanation: An SMG output routine is passed an escape sequence
   embedded in the output string. The output string is written to
   the virtual display but the string is terminated at the escape
   sequence.

   User Action: Check your output string to determine what escape
   sequence is being passed. If you need the action provided by this
   escape sequence, there is most likely an SMG routine that performs
   that function.


STRTNOMULTI

cannot request /START_BLOCK with multiple input files

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility does not allow the use of the
   /START_BLOCK qualifier when more than one input file is specified.

   User Action: Leave the /START_BLOCK qualifier off, or copy the
   files one at a time with the /START_BLOCK present.

STRTOOLARGE

string greater than 65535 characters

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A string operation has generated a string that
   exceeds 65,535 characters in length.

   User Action: Use an expression that generates a shorter string.

STRTOOLNG

string argument is too long-shorten

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The specified string argument is too long.

   User Action: Shorten the string argument.

specified string for parameter 'name' is too long

   Facility: SYSBOOT, System Bootstrap Facility and SYSGEN, System
   Generation Utility

   Explanation: A string specified in a SET command is longer than
   the maximum length for that parameter.

   User Action: Reenter the command specifying a shorter string.


STRTOOLON

string is too long (greater than 65535)

   Facility: STR, String Manipulation Facility

   Explanation: An attempt is made to create a string that is longer
   than allowed by the String Facility or the descriptors in the VMS
   Procedure Calling and Condition Handling Standard. The maximum
   length string supported is 65,535.

   User Action: Do not specify string lengths greater than 65,535.
   Check that a concatenation operation will not attempt to create a
   string longer than 65,535.

STRTRU

string truncated

   Facility: LIB, Library Facility

   Explanation: A Run-Time Library procedure returned a string that
   did not fit into the specified receiving area resulting in lost
   trailing characters. This message is associated with a status code
   returned from the Run-Time Library.

   User Action: Correct your program to increase the area specified
   to receive the string.

STRUCLEV

inconsistent structure level on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Files-11 structure level of the specified volume
   is different from other volumes in the same list of devices. The
   volume must not be part of the same volume set.

   User Action: Locate and mount the correct volume.

STRUCSIZE

structure size declared as 'num-units' allocation units, 'num-units'
was given

   Facility: DEBUG, VMS Debugger

   Explanation: The BLISS-32 structure size was declared to be 'num-
   units' units but was referenced with 'num-units' units. This
   message is informational.

   User Action: None.

STRUCT_LEVEL

system job queue file has incompatible structure level of 'number'

   Facility: JBC, Job Controller

   Explanation: After opening the system job queue file, the job
   controller determined that the internal format of the queue file
   or revision level is different from the format currently supported
   by the system. This situation usually occurs when an old queue
   file is used after installing a new release of VMS or after a
   maintenance update in which the queue file format has changed.

   User Action: Create a new queue file using the START/QUEUE/MANAGER
   /NEW_REVISION command, or delete the existing queue file and
   create a new file using the START/QUEUE/MANAGER command.

SUBABORT

subordinate process encountered error

   Facility: UETP, User Environment Test Package

   Explanation: A vector processor device test subordinate process
   encountered an error during testing. This error is received in
   relation to a previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

SUBALREXI

subprocess already exists for this display

   Facility: SMG, Screen Management Facility

   Explanation: A user tried to create a subprocess for a virtual
   display when one is already created. This is normal in a modular
   environment.

   User Action: None.

SUBINTERR

error initializing subordinate process

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

SUBLOCKS

cannot dequeue a lock with sublocks

   Facility: SYSTEM, VMS System Services

   Explanation: A programming error occurred because an attempt is
   made to dequeue a lock that had sublocks under it.

   User Action: Correct the programming error and retry. (Note that
   you may use the flag bit LCK$M_DEQALL on the $DEQ system service
   request to dequeue all the locks for a given access mode.)

SUBMITERR

error submitting file to queue 'queue-name'

   Facility: SUBMIT, SUBMIT Command

   Explanation: This message is issued with another message
   indicating the problem.

   User Action: Take corrective action based on the accompanying
   message.

SUBOUTBND

subscript 'subscript-number' is out of bounds value is 'subscript-
value', bounds are 'low-bound

   Facility: DEBUG, VMS Debugger

   Explanation: You attempted to use a subscript out of the bounds of
   an array.

   User Action: Change the value of the subscript.

SUBRNG

arithmetic trap, subscript out of range at PC = 'xxxxxxxx',
PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: A subscript out of range caused an arithmetic
   exception condition.

   User Action: Examine the PC location displayed in the message, and
   check the program listing to verify that operands or variables are
   specified correctly.

SUBSCHERR

error scheduling subordinate process

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

SUBSTRING

invalid substring (start: 'low-bound', end: 'high-bound'), object
has length 'string-size'

   Facility: DEBUG, VMS Debugger

   Explanation: The substring specification (start: 'low-bound', end:
   'high-bound' ) is not within the bounds defined for the data type.

   User Action: Specify a substring specification within the bounds
   defined for the data type.

SUBSPNERR

error spawning subordinate process

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

SUBSTSERR

error obtaining subordinate process status

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   which is the result of a previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

SUBTRACED

protected subsystem image cannot be linked /TRACE or /DEBUG

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt was made to activate an image with an
   associated protected subsystem ACE that was linked with either
   traceback information or a debug symbol table. For security
   reasons, protected subsystem images cannot contain either of these
   types of records.

   User Action: Link the image /NOTRACE and /NODEBUG.

SUCCDUPACE

current ACE will supersede succeeding ACE-not entered

   Facility: ACLEDIT, Access Control List Editor

   Explanation: An ACE exists after the current position within
   the ACL, which would be rendered useless by the current ACE. The
   current ACE is not entered.

   User Action: Modify or delete the current ACE or the succeeding
   occurrence of the ACE.

SUCCESS

normal successful completion

   Facility: CDU, Command Definition Utility

   Explanation: Your operation completed successfully.

   User Action: None.

SUP

network operation not supported; DAP code = 'xxxxxxxx'

   Facility: RMS, VMS Record Management Services

   Explanation: The requested VMS RMS operation failed because either
   the specified remote node does not support the function or VMS RMS
   does not support the function in a network context at the local
   node.

   User Action: Consult the VMS Networking Manual and the applicable
   DECnet manual for the remote node to determine which functions
   are supported by both the local and remote nodes. The status
   value (STV) field of the FAB or RAB contains a DAP status code.
   See the appropriate DECnet manual for the remote node for an
   interpretation of the DAP status code.

SUPERSEDE

created file superseded existing version

   Facility: RMS, VMS Record Management Services

   Explanation: The file created by a VMS RMS $CREATE operation
   superseded an existing version of the same file. This message
   indicates a success status.

   User Action: None.

logical name superseded

   Facility: SYSTEM, VMS System Services

   Explanation: A request to place a logical name in a logical name
   table completed successfully by replacing an existing logical
   name table entry. (Because this is a success message, it is not
   normally displayed.)

   If this message is returned from a call to an ACP, it indicates
   that an existing file with the same file name, type, and version
   number is deleted as the result of a CREATE request.

   User Action: None. Note the condition and modify the source
   program, if necessary, to detect and respond to the condition.

previous value of 'value' has been superseded

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You redefined the specified logical name.

   User Action: None.



SUPPORT

network operation not supported

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS rejected the request because it is not
   supported between two DECnet systems. The STV field contains
   either another VMS RMS completion code or a FAL status code,
   depending on whether VMS RMS at the local node or FAL at the
   remote node could not support the request.

   User Action: The status value (STV) field contains either an RMS
   status code or a $FAC status code that provides more information
   about the condition. Take corrective action based on this status
   code.

SUSPEND

system operation suspended; security auditing resources exhausted

   Facility: AUDSRV, Audit Server

   Explanation: The free disk space on the disk volume associated
   with the specified audit journal file has fallen below the
   resource action threshold. Consequently, the audit server has
   suspended all non-critical processes.

   User Action: Log into a privileged account and free up disk space
   on the disk volume associated with the specified audit journal
   file.

service routine pausing for other input

   Facility: PSM, Print Symbiont

   Explanation: This status is returned by a print symbiont format
   routine requesting the current input service routine be paused.

   User Action: None.


SUSPENDED

process is suspended

   Facility: SYSTEM, VMS System Services

   Explanation: The specified process is suspended or placed in
   miscellaneous wait state.

   User Action: The requested operation cannot be performed when
   the specified process is suspended. Resume process or retry the
   operation.

SWAPAGINS

second page/swap file already installed

   Facility: SYSGEN, System Generation Utility

   Explanation: Two second page or swap files were installed.

   User Action: If it is necessary to change the page/swap file,
   reboot and install the correct file.

SWAPWSLE

swap working set list entries error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

SYITSTERR

error encountered while testing $GETSYI system service

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   testing VMS system services. This error is received in relation to
   a previously displayed error condition or could be the result of a
   more serious VMS problem.

   User Action: If the condition causing the problem can be
   identified, correct the condition and re-run the test. If the
   error persists, submit a Software Performance Report. If the
   condition cannot be identified, run diagnostics for VAX Vectors or
   contact Digital customer service.

SYMABR

abbreviated symbols not allowed-remove "*" from symbol name

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You abbreviated a symbol using an asterisk (*)  or in
   a context where abbreviated symbol definitions are not valid.

   User Action: Remove the asterisk (*)  from the symbol name.

SYMCREPRC

error creating symbiont process for 'device-name'

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error creating
   an input symbiont process for card reader input on the specified
   device. The accompanying message provides additional information.

   User Action: Take action based on the accompanying message.

SYMDCLEXTR

symbol declared external

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A label definition or direct assignment statement
   specified a symbol that is previously declared external in an
   .EXTERNAL directive.

   User Action: Delete the external declaration or change the name of
   the internal symbol.

SYMDEFINMO

symbol is defined in module

   Facility: MACRO, VAX MACRO Assembler

   Explanation: An .EXTERNAL directive specified a label that is
   previously defined in the module.

   User Action: Delete the external declaration or rename the
   internal symbol.

SYMDEL

invalid symbol or value delimiter-check command syntax

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An illegal character is present on a command line
   containing a symbol definition. This error can also indicate that
   arguments were specified for a lexical function that does not
   require arguments.

   User Action: The rejected portion of the command is displayed
   between backslashes. Reenter the command.

unexpected symbiont process termination

   Facility: JBC, Job Controller

   Explanation: A symbiont process exited without having been
   requested to do so by the job controller. The accompanying message
   provides additional information.

   User Action: Take action based on the accompanying message.


SYMDELETE

error symbol deleted

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The error symbol was deleted in order for the
   compiler to continue compiling.

   User Action: None.

SYMINSERT

'name' inserted before error symbol

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: In order for the compiler to continue compiling,
   'name' was inserted before the error symbol.

   User Action: None.

SYMLNG

symbol name is too long-shorten the name

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You specified a symbol name that is too long.

   User Action: Shorten the symbol name.

SYMNAMLNG

'module-type' module 'module-name' file 'library-name ' has illegal
length 'nnn'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The specified module name exceeds the name length
   limit.

   User Action: Make sure that all the symbol names in the module are
   less than the library's name length limit or compress the library
   with a larger key length.

SYMNOTABS

symbol is not absolute

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The argument in a macro string operator is a relative
   symbol or is undefined.

   User Action: Ensure that the symbol is defined as an absolute
   symbol.

SYMNOTACT

nonstatic variable 'symbol-name' is not active

   Facility: DEBUG, VMS Debugger

   Explanation: The symbol 'symbol-name' is not defined in an active
   call frame.

   User Action: Check the symbol specified; if correct, ensure that
   you have defined the scope correctly.

SYMNOTFOU

global symbol !AS not found in shareable image !AS

   Facility: SET PASSWORD Utility

   Explanation: VMS was unable to locate the specified global routine
   in the named shareable image.

   User Action: Ensure that the routine declaration is properly
   declared as a GLOBAL symbol and that the LINK options file
   contains a UNIVERSAL option for the symbol.

SYMOUTPHAS

symbol out of phase

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A label definition specified a label that is defined
   later in the module; or a local label definition specified a local
   label that is defined later in the same local label block.

   User Action: Ensure that the label is defined only once in the
   module, or that the local label is defined only once in the local
   label block.

SYMOVF

no room for symbol definitions-delete some symbols

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The command interpreter cannot hold any more symbol
   definitions or labels. Note that this error can occur when a
   nested procedure is executed, because the command interpreter
   defines the symbols P1 through P8 before executing the procedure.

   If an ON condition is not established for warnings in the
   procedure, the procedure continues execution. However, the
   procedure may fail later if you refer to the symbol that could
   not be defined.

   User Action: If necessary, interrupt the command procedure with
   CTRL/Y to stop its execution. Use the DCL commands SHOW SYMBOL and
   SHOW KEY to determine how many global symbols and keypad symbols
   are defined; delete unused symbols to recover symbol table space.
   If the error occurs frequently, simplify the command procedure
   or procedures, and use local symbols within procedures whenever
   possible.

   You may also increase the size of the command language interpreter
   (CLI) symbol table by resetting the SYSGEN parameter CLISYMTBL.
   The format of the command is SYSGEN SET CLISYMTBL n, where n
   is the size of the table expressed in pages. The SYSGEN SHOW
   CLISYMTBL command shows you the default table size, and the range
   of allowable table sizes. Note that the SYSGEN SET command sets
   the new value for the duration of your process only. It does not
   change the permanent parameter value.

SYMREPLACE

error symbol replaced by 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The error symbol was replaced in order for the
   compiler to continue compiling.

   User Action: None.

SYMTOOLNG

string too long

   Facility: CDU, Command Definition Utility

   Explanation: You entered a command string that is too long and
   therefore invalid.

   User Action: Reenter a shorter command string.

symbol 'symbol-name' is too long to copy to subprocess

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: When you spawned a subprocess, a logical name, a
   logical value, a symbol name, or a symbol value is too long to be
   copied to the subprocess.

   User Action: Break the specified name or value into several parts.

symbol name too long

   Facility: MESSAGE, Message Utility

   Explanation: You have assigned a symbol name with more characters
   than are permitted.

   User Action: Shorten the symbol name.



SYMTOOLONG

the symbol 'symbol-name' is longer than 31 characters

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered a symbol name longer than 31
   characters while reading from a CLD file.

   User Action: Edit the CLD file so that symbol names are not
   greater than 31 characters in length.

SYMTRUNC

preceding symbol value has been truncated

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This informational message signifies that the symbol
   value displayed through the SHOW SYMBOL command is too large to be
   fully displayed. The value is truncated in the display.

   User Action: None.

SYN

file specification syntax error

   Facility: RMS, VMS Record Management Services

   Explanation: The file specification syntax string contains a
   syntax error. For example, invalid characters were used, or
   required punctuation marks were omitted.

   User Action: Correct the syntax and reenter the command or correct
   the program that caused the error.

SYNCH

synchronous successful completion

   Facility: SYSTEM, VMS System Services

   Explanation: This alternate success code indicates that the
   requested operation completed synchronously and as expected.

   User Action: None.

SYNERR

syntax error

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler encountered invalid syntax.
   For instance, there may be a misplaced or missing equals sign.

   User Action: Check your terminal definition.

SYNTAX

syntax error in statement 'number' 'reference-text'

   Facility: NCP, Network Control Program

   Explanation: An element in the command syntax could not be parsed.

   User Action: Reenter the command.

command syntax error at or near 'DEBUG-command-segment'

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger encountered a command syntax error near
   the element 'DEBUG-command-segment'.

   User Action: Reenter the command.

command syntax error at or near 'location'

   Facility: PATCH, Patch Utility

   Explanation: A syntax error in a file name has been discovered in
   a CREATE command.

   User Action: Reenter the command specifying the correct syntax.

syntax error

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: A syntax error is detected.

   User Action: Reenter the command with the correct syntax.

error parsing 'xxxx'

   Facility: ACCOUNTING, Accounting Utility

   Explanation: The command syntax is invalid. The message displays
   the rejected portion of the command.

   User Action: Use the DCL HELP command or refer to the VMS DCL
   Dictionary, for the correct syntax and reenter the command.

error parsing 'string'

   Facility: Shared by several facilities

   Explanation: The command syntax is invalid. The message displays
   the rejected portion of the command.

   User Action: Use the DCL command HELP or refer to the VMS DCL
   Dictionary for the correct syntax and reenter the command.

invalid ACE syntax

   Facility: ACLEDIT, Access Control List Editor

   Explanation: An error was encountered trying to parse the ACE
   currently being entered. The portion of the ACE after the point of
   error is displayed.

   User Action: Correct the error and enter the ACE again.

syntax error in statement 'n'

   Facility: FDL, Create/FDL Utility, FDL, Edit/FDL Utility

   Explanation: An FDL syntax error is encountered.

   User Action: Examine the specified line in the FDL file, determine
   which validity rule is violated, and correct the line.

syntax error: 'string'

   Facility: SYSGEN, System Generation Utility

   Explanation: A syntax error is detected. The 'string' part of the
   message displays the nonparsed input.

   User Action: Reenter the command with the correct syntax.









SYNTAXERR

string syntax error detected by LIB$TPARSE

   Facility: LIB, Library Facility

   Explanation: The string passed to the LIB$TPARSE library procedure
   contained a syntax error.

   User Action: Correct the syntax error in the string.

SYNTAXERROR

syntax error

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The program being compiled has a syntax error.

   User Action: Correct the syntax error and recompile your program.

SYS

QIO system service request failed

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS encountered an error while trying to issue a
   $QIO system service request for an I/O operation. This message may
   occur if calls to VMS RMS fail because of insufficient resource
   quotas; for example, if a process exceeds its AST limit quota.

   User Action: The status value (STV) field of the RAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.
   Check for a programming error that causes the process to exceed a
   resource quota required for VMS RMS I/O operations.

SYSADJWSL

system service adjust working set limit error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

SYSBOOT-E-Bad image header detected while checking system version

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The versions of the system loadable image being read
   do not match the current VMS operating system versions. The images
   on your system disk are incompatible.

   User Action: Obtain a new copy of the VMS system disk.

SYSBOOT-E-Device names not allowed

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: Device names are not valid when specifying a
   parameter with the USE command. The device defaults to the system
   root (usually the [SYS0.] directory on the system device).

   User Action: Reenter the command without a device name.

SYSBOOT-E-End of file error reading

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: An end-of-file error occurred while SYSBOOT was
   reading a system loadable image; the error message includes the
   file name. The system disk may be corrupted.

   User Action: Attempt to reboot the system or try a different
   drive. If this fails, obtain a new copy of the VMS system disk.

SYSBOOT-E-Error reading file

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: An irrecoverable error occurred while SYSBOOT was
   reading a parameter file in response to a USE command. The error
   message contains the file name.

   User Action: Reenter the command specifying the correct file name.

SYSBOOT-E-I/O error reading file

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: An irrecoverable I/O error occurred while SYSBOOT was
   reading a parameter file or a system loadable image. If the error
   occurred while a parameter file was being read, SYSBOOT does not
   perform the requested action. If the error occurred while a system
   loadable image was being read, SYSBOOT terminates the bootstrap
   operation.

   User Action: Attempt to reboot the system or try a different
   drive.

SYSBOOT-E-Not a parameter file

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: A file specified in a USE command is not a parameter
   file. The error message contains the file name.

   User Action: Reenter the command specifying a parameter file.

SYSBOOT-E-System version mismatch found

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The versions of the system loadable image being read
   do not match the current VMS operating system versions. The images
   on your system disk are incompatible.

   User Action: Obtain a new copy of the VMS system disk.

SYSBOOT-E-Unable to locate file

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT cannot locate a file; error message will
   contain the file name.

   User Action: Reenter the command specifying the correct file name
   or mount the correct medium in the console drive.

SYSBOOT-F-Boot time files have too many noncontiguous pieces

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: This error occurs during system initialization. The
   system dump, page, or swap file is overly fragmented, that is,
   approximately 100 pieces.

   User Action: Backup the system disk using the backup disk as the
   new system disk. The BACKUP Utility copies the files in a such way
   that the files consist of fewer fragments.

SYSBOOT-F-FBIC

version less than minimum required for VMS

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The hardware ECO level is below the level required
   for correct software operation.

   User Action: Call Digital customer service.

SYSBOOT-F-Invalid console ID

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The console type code in the console identification
   register does not correspond to any supported console device for
   the VAX-11 processor being booted.

   User Action: Call your DIGITAL field service representative.

SYSBOOT-F-Microcode revision level too low to boot

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The hardware ECO level for the VAX-11 processor being
   booted is below that required to boot the VMS system.

   User Action: Call your DIGITAL field service representative.

SYSBOOT-F-Not enough nonpaged pool to map

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT is unable to allocate sufficient nonpaged
   pool to map a driver or system loadable image. The error message
   will include the file name.

   User Action: Reboot the system with a larger value for NPAGEDYN.

SYSBOOT-F-Pageable system space exceeds 512 MB

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The size of pageable system space exceeds that which
   can safely be mapped with page file backing store.

   User Action: Reconfigure the system to require less pageable
   system space and reboot the system. Reduce one or more of the
   PAGEDYN and GBLPAGES parameters.

SYSBOOT-F-PFN allocation overwrites CI ucode

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The allocation of physical pages for the system
   page table, nonpaged dynamic pool, interrupt stack, and resident
   executive overwrites the CI microcode.

   User Action: Reconfigure the system to require less physical
   memory and reboot the system. Reduce one or more parameters
   controlling the allocation of physical memory: NPAGEDYN,
   BALSETCNT, and VIRTUALPAGECNT.

SYSBOOT-F-PFN bit map conflict-Physical page count set too low

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT cannot find sufficient contiguous pages of
   physical memory (within the bounds specified by the parameter
   PHYSICALPAGES) to contain the PFN bitmap.

   User Action: Reboot the system with a larger value for
   PHYSICALPAGES.

SYSBOOT-F-Switch of boot volume attempted with S0_PAGING=0, must be 1

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: An attempt was made to switch the boot volume while
   system paging was turned on. System paging must be turned off.

   User Action: Set the system parameter S0_PAGING to 1 and reboot.

SYSBOOT-F-System

revision less than minimum required for VMS

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The hardware ECO level is below the level required
   for correct software operation.

   User Action: Call Digital customer service.

SYSBOOT-F-Unable to allocate physical memory

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The sum of pages required for the system page table,
   nonpaged dynamic pool, interrupt stack, and resident executive
   exceeds available physical memory.

   User Action: Reconfigure the system to require less physical
   memory and reboot the system. Reduce one or more parameters
   controlling the allocation of physical memory: NPAGEDYN,
   BALSETCNT, and VIRTUALPAGECNT.

SYSBOOT-F-Unable to allocate PTEs for Boot Driver

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT is unable to allocate the system page table
   entries (PTEs) needed by the boot driver.

   User Action: Increase the value of parameter SPTREQ.

SYSBOOT-F-Unable to allocate SPT+PHD+SCB

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT cannot find enough contiguous pages of
   physical memory to contain the required system page table (SPT),
   process header (PHD), and system control block (SCB).

   User Action: Reduce parameters controlling SPT size:
   VIRTUALPAGECNT, BALSETCNT, REALTIME_SPTS, and SPTREQ.

SYSBOOT-F-Unable to locate storage bit map file

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT cannot locate the storage bitmap file
   (BITMAP.SYS) in directory [000000] on the system disk. The system
   disk is either defective or corrupted.

   User Action: Obtain a new copy of the VMS system disk.

SYSBOOT-F-Unable to locate SYS.EXE

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT cannot locate the system image file in
   directory [SYS$LDR] on the bootstrap volume.

   User Action: The system disk is either defective or corrupted, or
   the disk you are accessing is not the system disk. Obtain a new
   copy of the VMS system disk.

SYSBOOT-F-Unable to read continuation volume

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: An error occurred while trying to read the
   continuation volume when booting the VMS operating system from
   multiple volumes.

   User Action: Attempt to reboot the system; try a different drive
   or obtain a new copy of the VMS system disk.

SYSBOOT-F-Unexpected exception

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: An unexpected exception occurred indicating a
   probable hardware error or SYSBOOT logic error.

   User Action: Call your local field service representative.

SYSBOOT-F-Unexpected machine check

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: An unexpected machine check occurred indicating a
   probable hardware error or SYSBOOT logic error.

   User Action: Call your local field service representative.

SYSBOOT-F-Unknown processor

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The processor type code in the system identification
   register does not correspond to any supported model of a VAX-11
   processor.

   User Action: Call your local field service representative.

SYSBOOT-W-DMPFRG SYSDUMP.DMP is too fragmented to be used

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The system dump file is severely fragmented.

   User Action: Back up the system disk and use the backup disk as
   the new system disk.

SYSBOOT-W-ECO level less than minimum required for VMS.

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The hardware ECO level is below the level required
   for correct software operation.

   User Action: Call your local field service representative. You may
   continue the bootstrap operation but the integrity of the software
   may be compromised.

SYSBOOT-W-FPLA, PCS, or WCS version less than minimum required for VMS

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The hardware ECO level is below the level required
   for correct software operation.

   User Action: Call your local field service representative. You may
   continue the bootstrap operation but the integrity of the software
   may be compromised.

SYSBOOT-W-Maximum WS raised to PHD+MINWSCNT

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT raised the specified maximum working set
   size to accommodate the minimum working set size allowed by VMS.
   To execute, every process requires a minimum fluid working set
   (MINWSCNT) plus space for its process header (PHD).

   User Action: None.

SYSBOOT-W-Microcode patch level less than minimum required for VMS.

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The hardware ECO level is below the level required
   for correct software operation.

   User Action: Call your local field service representative. You may
   continue the bootstrap operation but the integrity of the software
   may be compromised.

SYSBOOT-W-Microcode version less than minimum required for VMS.

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The hardware ECO level is below the level required
   for correct software operation.

   User Action: Call your local field service representative. You may
   continue the bootstrap operation but the integrity of the software
   may be compromised.

SYSBOOT-W-Primary home block is bad

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The primary home block of the system disk could not
   be read and an alternate block was selected for use as the home
   block.

   User Action: Back up the system disk and then use the backup
   disk as the new system disk. The current system disk should be
   reinitialized.

SYSBOOT-W-System ROM version less than minimum required for VMS

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The hardware ECO level is below the level required
   for correct software operation.

   User Action: Call your local field service representative. You may
   continue the bootstrap operation but the integrity of the software
   may be compromised.

SYSBOOT-W-WS default and quota raised to PDH+MINWSCNT

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: SYSBOOT raised the default working set size you
   specified to accommodate the sizes of the process header plus
   the minimum fluid working set size.

   User Action: None.

SYSDEV

the system device cannot be dismounted

   Facility: DISMOUNT, DISMOUNT Command

   Explanation: The device name specified in the DCL command DISMOUNT
   is the system volume.

   User Action: Verify the device name (or logical name, if a logical
   name is specified) in the command and reenter the DCL command
   DISMOUNT specifying the correct device.

SYSDIR

this product creates system directory 'directory-name'

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product being installed creates the specified
   system directory.

   User Action: None.

SYSDISK

this product creates system disk directory 'directory-name'

   Facility: VMSINSTAL, Install Procedures

   Explanation: The product being installed creates a directory on
   the system disk.

   User Action: None.

SYSERROR

system service error

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An error occurred while executing one of the VMS
   system services. An accompanying message explains which service
   failed and why it failed.

   User Action: Take action based on the accompanying VMS message.

system service error

   Facility: Shared by several facilities

   Explanation: An error is detected by a system service. A
   subsequent message explains the reason for the error.

   User Action: Take corrective action based on the associated
   message.

system service error

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An error occurred while VAXTPU is using one of the
   VMS system services. An accompanying message from the system
   service should explain why the error occurred.

   User Action: Follow the recovery procedure for the system service
   message.



SYSERRORPC

'name' system service error at PC = 'location'

   Facility: Shared by several facilities

   Explanation: An error is detected by a system service. A
   subsequent message explains the reason for the error.

   User Action: Take corrective action based on the associated
   message.

SYSERROR[[PC]]

'testname' system service error [[at PC 'location']]

   Facility: UETP, User Environment Test Package

   Explanation: This message is no longer used.

   User Action: None.

SYSFAIL

system failed during execution

   Facility: JBC, Job Controller

   Explanation: The system crashed during execution of the affected
   job or queue management command.

   User Action: Resubmit the job or reenter the command.

SYSFAOERR

unexpected error from SYS$FAO

   Facility: DIFF, DIFFERENCES Command

   Explanation: An unexpected error occurred during a call to the
   $FAO system service.

   User Action: Submit a Software Performance Report (SPR).

SYSID

error while obtaining system ID message

   Facility: CNF, NI Configurator

   Explanation: An error occurred during the read to the NI device
   driver.

   User Action: See the accompanying message to determine the
   appropriate action.

SYSINIT-E-create process error on STARTUP

   Facility: SYSINIT, System Initialization

   Explanation: An error occurred while creating the STARTUP process.
   An accompanying message provides more information.

   User Action: Take corrective action based on the accompanying
   message and reboot the system.

SYSINIT-E-error allocating pool-error log buffers not copied

   Facility: SYSINIT, System Initialization

   Explanation: There was insufficient nonpaged pool available to
   allocate the error log recovery buffer used to store the error log
   messages for ERRFMT to copy out later to the error log file. Since
   not enough pool is available to allocate the storage area, the
   error log messages cannot be saved.

   User Action: Increase the SYSGEN parameter NPAGEDYN so that enough
   nonpaged pool is available to allocate the error log recovery
   buffer.

SYSINIT-E-error creating shadowed system disk, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: An error was encountered when creating the shadowed
   system disk. The 'status' field provides the actual failure status
   represented as a hexadecimal number.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization, which can determine
   the ident for you.

SYSINIT-E-error loading message file, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: The system message file, SYS$MESSGAE:SYSMSG.EXE,
   could not be loaded into the system. The 'status' field provides
   the failure status represented as a hexadecimal number.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization to determine the ident
   for you.

SYSINIT-E-error loading RECOVERY_UNIT_SERVICES.EXE, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: The VMS RECOVERY_UNIT_SERVICES image, SYS$LOADABLE_
   IMAGES:RECOVERY_UNIT_SERVICES.EXE, could not be loaded into the
   system. The 'status' field provides the failure status represented
   as a hexadecimal number.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization to determine the ident
   for you.

SYSINIT-E-error loading RMS.EXE, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: The VMS RMS image, SYS$LOADABLE_IMAGES:RMS.EXE, could
   not be loaded into the system. The 'status' field provides the
   failure status represented as a hexadecimal number.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization to determine the ident
   for you.

SYSINIT-E-error mounting system device

   Facility: SYSINIT, System Initialization

   Explanation: An error condition is preventing the system disk from
   being mounted. In general, these error conditions are no different
   from errors that prevent other volumes from being mounted, such as
   a random I/O error, a corrupted file system, or an incorrect ACP
   image.

   User Action: Correct the problem that is preventing the system
   disk from being mounted and reboot the system.

SYSINIT-E-error opening or mapping F11BXQP, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: The VMS file system, SYS$SYSTEM:F11BXQP.EXE, could
   not be opened or mapped. The 'status' field provides the failure
   status represented as a hexadecimal number.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization to determine the ident
   for you.

SYSINIT-E-error opening page file, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: The primary paging file, SYS$SYSTEM:PAGEFILE.SYS,
   could not be opened. The 'status' field provides the failure
   status.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization to determine the ident
   for you.

SYSINIT-E-error opening swap file, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: The system swap file, SYS$SYSTEM:SWAPFILE.SYS, could
   not be opened. The 'status' field provides the actual failure
   status.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization to determine the ident
   for you.

SYSINIT-E-error opening system dump file, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: The system dump file, SYS$MESSAGE:SYSDUMP.DMP, could
   not be loaded into the system. The 'status' field provides the
   failure status represented as a hexadecimal number.

   User Action: If you do not have a running system available to
   determine the ident, contact your software support organization to
   determine the ident for you.

SYSINIT-E-error reading system dump file error log buffers, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: An error occurred while reading the error log
   buffers in from the dump file. The hexadecimal error status value
   described by 'status' is the failure status returned after the
   read operation failed.

   User Action: Check the system dump file for disk errors. It might
   be necessary to create a new dump file.

SYSINIT-E-error taking out lock on system disk, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: An error was encountered when acquiring a cluster-
   wide lock on the system device. The 'status' field provides the
   actual failure status.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization to determine the ident
   for you.

SYSINIT-E-failed to create system logical names

   Facility: SYSINIT, System Initialization

   Explanation: An error occurred while attempting to create
   a logical name needed by SYSINIT (SYS$SYSTEM, SYS$SHARE,
   SYS$MESSAGE). The complete list of errors that can occur when
   creating logical names is given in the VMS System Services
   Reference Manual. The error that occurred while SYSINIT was
   executing (assuming that the SYSINIT image is not corrupted) is
   due to insufficient paged dynamic memory.

   User Action: Set the SYSGEN parameter PAGEDYN to a reasonable
   value (at least 10,000) and reboot the system.

SYSINIT-E-invalid date/time

   Facility: SYSINIT, System Initialization

   Explanation: A syntax error is detected in the date or time that
   is typed to set the system time.

   User Action: Enter the date or time in the correct format.

SYSINIT-E-page file or swap file control block initialization error

   Facility: SYSINIT, System Initialization

   Explanation: An error occurred, for one of the following reasons,
   while attempting to install the primary paging or swap file:

   o  There is not enough nonpaged pool for the PFL bitmap.

   o  The SYSGEN parameter, PAGFILCNT, is set to zero.

   o  The file is badly fragmented and an error occurred while trying
      to map the file completely.

   User Action: Correct the error using one of the following methods
   and reboot the system:

   o  If there is not enough nonpaged pool, see the message INSFMEM
      for information about making enough nonpaged pool available for
      booting the system.

   o  Do not set PAGFILCNT to zero.

   o  You can prevent the complete mapping of a file if there is not
      enough nonpaged dynamic memory or if the SYSGEN parameter PQL_
      DBYTLM is set too small.

SYSINIT-E-recoverable error encountered when mounting system device, status= 'status'

   Facility: SYSINIT, System Initialization

   Explanation: A recoverable disk I/O error was encountered when
   mounting the system disk. The mount operation will be retried
   automatically.

   User Action: None.

SYSINIT-E-unable to obtain lock for system ID resource, status = 'status'

   Facility: SYSINIT, System Initialization

   Explanation: An error was encountered when acquiring a system-
   owned lock whose name contains the system ID. The 'status' field
   provides the failure status represented as a hexadecimal number.

   User Action: Try to determine the cause of the failure. If you
   do not have a running system available to determine the ident,
   contact your software support organization to determine the ident
   for you.

SYSINIT-I- no dump file-error log buffers not saved

   Facility: SYSINIT, System Initialization

   Explanation: The system disk does not have either a dump file
   SYSDUMP.DMP or a page file PAGEFILE.SYS; therefore, the contents
   of the error log buffers at the time of the last shutdown/crash
   that were saved in the dump file are not available for recovery
   from the dump file into the error log buffer recovery area.

   User Action: Create a page file PAGEFILE.SYS or a dump file
   SYSDUMP.DMP on the system disk, and reboot the system so that
   a dump file is available and error log buffers are saved across a
   shutdown or system failure.

SYSINIT-I- PAGEFILE.SYS not found-system initialization continuing . . .

   Facility: SYSINIT, System Initialization

   Explanation: The primary paging file, SYS$SYSTEM:PAGEFILE.SYS
   could not be found.

   User Action: Use the command procedure SYS$UPDATE:SWAPFILES.COM
   to place a page file in the system directory SYS$SYSTEM.
   Alternatively, you can install one or more secondary page files by
   editing the SYS$SPECIFIC:[SYSMGR]SYPAGSWPFILES.COM file.

SYSINIT-W- dump file write errors-error log buffers not saved

   Facility: SYSINIT, System Initialization

   Explanation: Since the entire dump file contents are suspect, the
   dump file write is not successfully completed, and no attempt is
   made to recover the saved error log messages from the dump file.

   User Action: None.

SYSINIT-W- invalid dump header version-error log buffers not saved

   Facility: SYSINIT, System Initialization

   Explanation: The dump file contains the contents of a dump written
   under a version of the VMS operating system different from the
   version that is being booted now. Therefore, the error log
   messages saved in the dump file are not read out from the dump
   file, since the format of the dump file and error log messages may
   be different from that format being used on this version.

   User Action: None required. This message is primarily to warn
   users that some error log messages have been lost.

SYSJNLFULL

device full error on journal SECURITY; automatic server restart
suppressed

   Facility: AUDSRV, Audit Server

   Explanation: The device associated with the system security
   audit journal file is full. When this event occurs, the audit
   server will not restart itself. Buffered security alarms received
   prior to the error will be stored in the process dump file,
   SYS$SYSROOT:[SYSEXE]AUDIT_SERVER.DMP.

   User Action: Free up space on the system volume and restart the
   audit server process using the command SET AUDIT/SERVER=START.

SYSJNLNAC

system audit journal inaccessible; SYS$COMMON:[SYSMGR]SECURITY_
AUDIT.AUDIT$JOURNAL used instead

   Facility: AUDSRV, Audit Server

   Explanation: The audit server process cannot open the system
   security audit log file. This condition occurs, for example,
   when the device on which the log file resides is unavailable or
   full. Audit messages are redirected to the default system security
   audit log file SECURITY_AUDIT.AUDIT$JOURNAL in the SYS$MANAGER
   directory.

   User Action: Correct the device problem and redirect the system
   security audit log file to the alternate device.

SYSLOAD

system loaded from node 'node-name'

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: This message indicates that the NISCS bootstrap is
   starting execution. This is an informational message.

   User Action: None.

SYSMGT

system specific mangement function not supported

   Facility: NCP, Network Control Program

   Explanation: The requested function cannot be performed because it
   is a system-specific function that is not supported on the system
   where the command is executed.

   User Action: Examine the provided system-specific error message,
   if present.

SYSMSG2

error code 'hex code' not found

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The $GETMSG system service could not find a
   corresponding message for the specified error code, which probably
   indicates that the code is incorrect. Since an incorrect error
   code obviously should not be generated, this message probably
   indicates an internal software error.

   User Action: Submit a Software Performance Report that describes
   the conditions leading to the error.

SYSNAM

NICONFIG requires SYSNAM privilege

   Facility: CNF, NI Configurator

   Explanation: NICONFIG must run with SYSNAM privilege in order
   to declare itself as a known image to be eligible for multiple
   connects.

   User Action: Install NICONFIG with SYSNAM privilege or run from an
   account with SYSNAM privilege.

SYSNOTUPD

I/O database not updated for volume 'volume'

   Facility: SET, SET Facility

   Explanation: The attempt to modify the volume's home block is
   successful, but the system information about the volume is not
   updated.

   User Action: To ensure that no ambiguities exist in the system
   I/O database, the volume should be dismounted and then remounted.
   Until then, a SHOW DEVICE of the drive on which the volume is
   mounted will still show the old volume characteristics.

SYSPWDMOD

system password modified

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The system password has been changed to the password
   directed by your command.

   User Action: None.

SYSSRVERR

error encountered during vector system services testing

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   testing VMS system services. This error is received in relation to
   a previously displayed error condition or could be the result of a
   more serious VMS problem.

   User Action: If the condition causing the problem can be
   identified, correct the condition and re-run the test. If the
   error persists, submit a Software Performance Report. If the
   condition cannot be identified, run diagnostics for VAX Vectors or
   contact Digital customer service.

SYSTRMERR

SYSINIT-terminal IO error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

SYSVERCHK

system version mismatch-function aborted

   Facility: SYSGEN, System Generation Utility

   Explanation: An attempt to do a WRITE CURRENT operation failed
   because the version of SYSGEN.EXE does not match SYS.EXE.

   User Action: Reenter the command with the proper version of
   SYSGEN.EXE.

SYSVERDIF

privilege removed-system version mismatch-please relink

   Facility: SYSTEM, VMS System Services and RMS, VMS Record
   Management Services

   Explanation: A SYS.STB that links the image being run is different
   from that of the currently running system.

   User Action: Relink the image. The image is allowed to run without
   CMEXEC or CMKRNL privilege.

system version mismatch-please relink

   Facility: INSTALL, Install Utility

   Explanation: The image being installed is not linked against the
   current version of the system.

   User Action: Relink the image and retry the installation.

system version mismatch-reassemble and relink driver

   Facility: SYSGEN, System Generation Utility

   Explanation: You have encountered a driver mismatch.

   User Action: Reassemble and relink all drivers at each major
   release of VMS.



SZTOOBIG

record size or block size greater than 65534

   Facility: MOUNT, Mount Utility

   Explanation: The record size or block size specified by
   /RECORDSIZE or /BLOCKSIZE is greater than 65,534.

   User Action: Check the source program and make the necessary
   correction.

TABEXIST

'table-name' already exists-not superseded

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This informational message signifies that the CREATE
   /NAME_TABLE command without the SUPERSEDE attribute specified
   encountered a table with the same name as the one it is about to
   create. A new table is not created.

   User Action: If the existing table is to be replaced by a
   new table, reenter the command with the /ATTRIBUTES=SUPERSEDE
   qualifier.

TABID_MIS

terminal table id mismatch

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable internal consistency check failed. The
   routines that fetch information from Termtable have a different
   version number than the Termtable data.

   User Action: The routines that fetch the data may be newer
   than your Termtable.EXE. Recompile TERMTABLE.TXT to update your
   TERMTABLE.EXE.

TABLEFULL

element ID table overflow

   Facility: MONITOR, Monitor Utility

   Explanation: A MONITOR request for a component class is terminated
   prematurely because of an overflow of an internal buffer.

   User Action: Reexecute the MONITOR request. Please submit an SPR
   including a transcription of the exact MONITOR command entered and
   a dump of the MONITOR image.

TABNOTFND

previous table 'table-name' is not found-new table created

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This informational message signifies that the
   CREATE/NAME_TABLE/ATTRIBUTES=SUPERSEDE command could not find
   an existing table of the same name. The new table is created.

   User Action: None.

TABSUPER

previous table 'table-name' has been superseded

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: This informational message signifies that the CREATE
   /NAME_TABLE/ATTRIBUTES=SUPERSEDE command found an existing table
   with the same name and replaced it with a new table.

   User Action: None.

TAMPER

file 'filename' has been tampered with.

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL is attempting to update a system text file,
   but the file has been modified locally. VMSINSTAL cannot update
   the file.

   User Action: DIGITAL software cannot update system text files that
   you have modified.

TAPECLASS

fatal error detected by Tape Class driver (TUDRIVER)

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

TAPEFULL

'save-set-spec' is full

   Facility: BACKUP, Backup Utility

   Explanation: The specified volume contains file data that extends
   past the end-of-tape reflective strip, indicating that no space is
   available for more data.

   User Action: Retry the operation using another volume.

TAPEPOSLOST

magnetic tape position lost

   Facility: SYSTEM, VMS System Services

   Explanation: The magnetic tape ACP (ancillary control process)
   lost the current position on the tape and cannot continue
   processing.

   User Action: Close all open files. Dismount and remount the tape
   and position it to the desired position, if possible. If the error
   persists, the tape may be defective.

TAPES

tapes

   Facility: OPCOM, Operator Communication

   Explanation: This message is issued when operator status is
   requested either explicitly by the REPLY/STATUS command or
   implicitly as with the REPLY/ENABLE command. It indicates that
   the operator's terminal is enabled for "TAPES" class operations.

   User Action: None.

TAR

no text allowed after .REQUIRE command: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You attempted to insert commands or text directly
   following a .REQUIRE command file specification.

   User Action: Put the commands on a separate line.

TBIT

T-bit pending trap at PC = 'location', PSL = 'xxxxxxxx'

   Facility: SYSTEM, VMS System Services

   Explanation: This message indicates an exception condition. It
   is usually followed by a display of the condition arguments,
   registers, and stack at the time of the exception.

   User Action: Examine the PC and virtual address displayed in the
   message to determine the instruction that caused the error.

TBKBUG

please report TRACE bug no. 'nnn'

   Facility: TRACE, Traceback Facility

   Explanation: An internal coding error occurred in the traceback
   program.

   User Action: Collect as much information as possible and submit
   a Software Performance Report (SPR). Include the bug number
   displayed in the message in the Report (SPR).

TERMDSBL

terminal disabled, operator 'operator-name'

   Facility: OPCOM, Operator Communication

   Explanation: A terminal is successfully disabled with the DCL
   command REPLY/DISABLE.

   User Action: None.

TERMENAB

terminal enabled, operator 'operator-name'

   Facility: OPCOM, Operator Communication

   Explanation: A terminal is successfully enabled with the DCL
   command REPLY/ENABLE.

   User Action: None.

TERMFAIL

failed to enable terminal

   Facility: OPCOM, Operator Communication

   Explanation: This message is a response to a REPLY/ENABLE request
   indicating that your request to OPCOM is rejected.

   User Action: Ask you, system manager to give you OPER privilege
   and try again.

TEROUT

error code of 'xx' parsing command file

   Facility: PATCH, Patch Utility

   Explanation: A command interpreter callback request failed due to
   the error code being represented as 'xx'.

   User Action: Correct the error code (represented as 'xx') and
   retry.

TEXT

'message'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The message text is displayed and should describe the
   problem.

   User Action: Take action based on the content of the message text.

'text'

   Facility: UETP, User Environment Test Package

   Explanation: Some UETP tests use this message to convey
   information that is usually self-explanatory. The device tests,
   for example, use this message to explain why a device failed its
   test.

   User Action: In most cases no user action is indicated by this
   message itself. Take the action implied by the other messages that
   usually accompany it. In other cases, the text should explain the
   nature of the problem.

no input file given

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The DCL command MACRO did not contain any source
   files; it contained only macro library files.

   User Action: Specify a source file in the command line.



TEXTD

'string'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: This message accompanies one or more other messages
   that describe an error condition. This message displays the text
   that is being processed when the error occurred.

   User Action: Correct the text by editing the source file.

entry text: 'string'

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: The indicated index entry caused this error. This
   message accompanies one or more other messages.

   User Action: Correct the entry in error by editing the source
   file.


TFE

too few end commands

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: An .END command (for example, .END LIST) is missing.

   User Action: Insert the missing .END command.

TFRSYS

transfer address in system image 'image-name' ignored

   Facility: LINK, Linker Utility

   Explanation: The linker encountered a transfer address in the
   creation of a system image. System images cannot have transfer
   addresses.

   User Action: Remove the transfer address.

That key is not definable

   Facility: EDT, EDT Editor

   Explanation: The key selected for the EDT command DEFINE KEY is
   not available for definition.

   User Action: Select a different key to define.

THIRDPARTY

logical link disconnected by a third party

   Facility: SYSTEM, VMS System Services

   Explanation: A DECnet-VAX logical link is disconnected by a system
   manager at some location in the network.

   User Action: Reinitiate the connection.

TIMEOUT

built-in timed out

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedure timed out.

   User Action: A software error has occurred. Please submit a
   Software Performance Report (SPR).

a timeout has occurred

   Facility: Shared by several facilities

   Explanation: This is an informational message telling you that the
   output device has timed out.

   User Action: None.

device timeout

   Facility: SYSTEM, VMS System Services

   Explanation: An input operation did not complete because the
   timeout period specified with the request elapsed before the input
   was received.

   If this message is associated with a status code returned by a
   request to an LPA11-K driver, a device timeout occurred. (Only for
   the start microprocessor, initialize LPA11-K, set clock, and start
   data transfer request functions.) An interrupt is not received
   within one second after the request is issued.

   If this message is associated with a status code returned by a
   request to a DR11-W interface driver, the timeout period specified
   for this request is exceeded. A device reset is issued to the
   DR11-W when the timeout occurs.

   If this message is associated with a status code returned by a
   request to a terminal driver, the specified terminal could not
   perform the QIO read operation because a timeout occurred at the
   terminal. In other words, an interrupt is lost, or IO$M_TIMED is
   specified on a read operation, or a hardware timeout occurred.
   IOSB+2 contains the number of bytes transferred before the timeout
   occurred. If associated with a DECnet-VAX operation, the connect
   request is not completed within the maximum time.

   User Action: The action to take depends on the context of the
   command or application. For example, if a timeout occurs during
   the execution of a DCL command MOUNT, verify that the physical
   device is ready and that the volume is properly loaded on the
   device.

disk boot driver initialization timeout

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: The boot node could not respond to the MSCP messages
   within the timeout interval.

   User Action: Check for resource deprivation on the boot node or an
   overloaded Ethernet.




TIPCUFLOW

NETACP-transmit count underflow

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

TIRLNG

object command data overflows record by 'decimal-number' bytes in
module 'module-name' record 'record-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The object record is not long enough to contain all
   required data.

   User Action: Submit a Software Performance Report on the
   appropriate language processor.

TIRNYI

unimplemented TIR command ('decimal-number') encountered in module
'module-name' record 'record-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An object module contained an object language command
   that is not implemented.

   User Action: Submit a Software Performance Report on the
   appropriate language processor.

TITLE

empty ident or title

   Facility: FDL, Edit/FDL Utility

   Explanation: There is no string value specified for the TITLE
   primary.

   User Action: You can either ignore this message or modify the FDL
   file and supply a value for the TITLE primary.

TITLETRUNC

maximum length of 'n' exceeded, title truncated

   Facility: ACCOUNTING, Accounting Utility

   Explanation: The length of the title string specified by the
   /TITLE qualifier is too long. The title string will be truncated
   to the maximum length specified in the error message.

   User Action: Reduce the length of the title string.

TKNOVF

command element is too long-shorten

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: An element, that is, any string placed between two
   delimiters, in the command line exceeded the maximum length of 255
   bytes.

   User Action: Reenter the command with the element shortened.

TLKINUSE

DECTalk is in use

   Facility: DTK, DECtalk Facility

   Explanation: A DTK$ routine is called from an AST routine that
   interrupted a DTK$ routine with the same voice_id argument.

   User Action: Correct the code to call the routine with the correct
   synchronization.

TMF

too many footnotes, excess footnotes merged

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You have more than twenty footnotes in a file. All
   footnotes after the twentieth are merged into one large footnote
   and output after the next page of text. (This large footnote will
   probably exceed the page length.)

   User Action: Use fewer footnotes, shorten them, or spread them
   out.

TMO

timeout period expired

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS operation specified a timeout period and
   the timeout period expired before the operation completed. The
   user buffer contains the input characters (if any) received before
   the timeout period expired.

   User Action: If this message occurs during the login procedure,
   repeat the procedure. If the request is for a record lock, the
   lock request is not granted. Other actions depend on the program
   issuing the request; user programs should be coded to detect and
   respond to I/O timeouts.

TMP

too many page ranges on /PAGES qualifier

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: More than five separate page ranges have been
   specified with the qualifier.

   User Action: Reduce the number of ranges specified.

TMPMBX

NICONFIG requires TMPMBX

   Facility: CNF, NI Configurator

   Explanation: NICONFIG must run with TMPMBX privilege.

   User Action: Install NICONFIG with TMPMBX privilege or run from an
   account with TMPMBX privilege.

TMR

SETIMR system service request failed

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS operation specified a timeout period and
   the attempt to declare the system timer failed. The operation is
   aborted.

   User Action: Verify that sufficient TQE quota is available by
   entering the SHOW PROCESS/QUOTA command. If necessary, increase
   the TQE quota, and try the operation again; or modify the program
   so there are not too many $SETIMR requests simultaneously.

TMS

too many saves, corresponding .SAVE and .RESTORE ignored

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You have nested more than 20 .SAVE directives.

   User Action: Correct your program to nest fewer than 20 .SAVE
   directives.

TMT

too many tab settings; excess ignored: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: More than 40 separate settings were used with a
   single .TAB STOPS command.

   User Action: Reduce the number of tab settings.

TMV

too many /VARIANTs

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: More than 20 variable names were used with the
   qualifier.

   User Action: Reduce the number of variable names.

TNS

terminator not seen

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS $GET service request to a terminal
   terminated when the user buffer is filled to capacity. No record
   terminator is encountered. Subsequent $GET service requests can
   retrieve additional characters from the input line.

   User Action: Modify the source program, if necessary, to detect
   and respond to the condition or provide a user buffer large
   enough to contain an entire input line, including the terminator
   sequence.

TOODEEP

maximum subindex depth exceeded

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: The number of levels of subindex entries has been
   exceeded.

   User Action: Check the subindex entries.

TOOFEW

too few arguments

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have not specified all of the arguments required
   by the built-in procedure you want to execute.

   User Action: Reenter the procedure with all of the required
   arguments. If you do not know the correct arguments, check the
   description of the built-in procedure in the VAX Text Processing
   Utility Manual, or use online help.

TOOLONG

specified parameter is too long (over 255 characters)

   Facility: DTK, DECtalk Facility

   Explanation: The length of the specified string is too long.

   User Action: Correct your program so that it requests a phone
   number or dictionary substitution of 255 characters or fewer.

TOOMANCLS

number of classes in text library module greater than allowable
classes

   Facility: ERF, Error Log Utility

   Explanation: An inconsistency in the text library was encountered.

   User Action: Submit a Software Performance Report (SPR).

TOOMANDIS

too many displays

   Facility: SMG, Screen Management Facility

   Explanation: An internal limit on the number of virtual displays
   that your program may have has been exceeded. The limit is
   currently 255. This includes any virtual displays that some outer
   routine may be using. This includes displays on all pasteboards.

   User Action: Use fewer virtual displays. Make sure that your
   program is not in a loop creating virtual displays. Be sure that
   you delete a virtual display when you are done with it.

TOOMANERR

too many errors, some errors not reported

   Facility: DEBUG, VMS Debugger

   Explanation: Too many MISMODBEG or certain other errors
   occurred. Other similar errors are not reported. This message
   is informational.

   User Action: None.

TOOMANNOD

too many nodes in node list-must be shortened

   Facility: SMI, System Management Intergator/Server

   Explanation: The result of an ENABLE or DISABLE operation would
   force the list of nodes for an entry to surpass the maximum
   length.

   User Action: Check if the node list can be shortened by changing
   the operation from ENABLE to DISABLE, or from DISABLE to ENABLE.

TOOMANPAS

too many pasteboards

   Facility: SMG, Screen Management Facility

   Explanation: An internal limit on the number of pasteboards that
   your program may have has been exceeded. The current limit is 31.

   User Action: Use fewer pasteboards.

TOOMANY

too many arguments

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have specified too many arguments to the built-in
   procedure you want to execute.

   User Action: Locate and remove the extra argument or arguments.
   Then reenter the procedure. If you do not know the correct
   arguments, check the description of the built-in procedure in
   the VAX Text Processing Utility Manual, or use online help.

TOOMANYARGS

more arguments than defined in routine table

   Facility: SMI, System Management Intergator/Server

   Explanation: This is an internal error. SMI is trying to send a
   call to a remote node, and the argument list is longer than the
   maximum length defined for the object.

   User Action: Submit a Software Performance Report showing the
   sequence of SYSMAN commands leading to the error.

TOOMANYCOL

too many columns, reduced number to fit listing width

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered a DIRECTORY /COLUMNS
   value too large for the display line. EXCHANGE has used the
   largest number of columns which will fit on the line.

   User Action: None.

TOOMANYLEV

too many levels of nested input detected in record 'record number'

   Facility: PSM, Print Symbiont

   Explanation: This status is returned indicating too many levels of
   nested input detected in this record number.

   User Action: Please submit a Software Performance Report (SPR).

TOOMANYLNAM

logical name translation exceeded allowed depth

   Facility: SYSTEM, VMS System Services

   Explanation: Ten translations were performed on the logical name;
   however, the name has not been translated.

   User Action: Display all logical name tables and remove those
   entries that caused the problem.

TOOMANYPARAM

too many formal parameters/local variables at line 'integer'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A maximum of 31 formal parameters or local variables
   is permitted.

   User Action: Reduce the number of formal parameters or local
   variables to less than 31.

TOOMANYREDS

too many redirects

   Facility: SYSTEM, VMS System Services

   Explanation: This call is redirected more than eight times.

   User Action: Modify your program so that it performs fewer levels
   of call redirection.

TOOMANYVER

too many higher file versions

   Facility: SYSTEM, VMS System Services

   Explanation: The maximum number of file versions already exists
   for the specified file, and all existing version numbers were
   greater than the specified version number.

   User Action: Change the version limit of the file or delete some
   of the existing versions.

TOO_MNY

too many of this device type

   Facility: SYSGEN, System Generation Utility

   Explanation: The SYSGEN command CONFIGURE is entered with too many
   controllers specified for a given type.

   User Action: Reenter the SYSGEN command CONFIGURE with the correct
   number of controllers.

TOOMNYARG

too many arguments

   Facility: LBR, Librarian Subroutine Package

   Explanation: A call to a librarian function passed more arguments
   than were expected.

   User Action: Reduce the number of arguments so that the call is in
   the correct format.

TOOMNYARGS

too many arguments in MACRO call

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The macro call contained more arguments than were
   specified in the .MACRO directive in the macro definition.

   User Action: Ensure that the macro call corresponds to the macro
   definition.

TOOMNYDLM

more than maximum of 'n' comment delimiters specified

   Facility: DIFF, DIFFERENCES Command

   Explanation: Too many comment delimiters were specified.

   User Action: Reenter the command, specifying one less than 'n'
   comment delimiters.

TOOMNYENDR

too many .ENDR in macro 'macro-name' in 'library-name'

   Facility: LIBRAR, LIBRARY Command

   Explanation: The specified MACRO contains an unmatched .ENDR.

   User Action: Reformat the macro source file.

TOOMNYFIL

more than two input files specified

   Facility: DIFF, DIFFERENCES Command

   Explanation: Too many input files were specified.

   User Action: Reenter the command; specify no more than two input
   files.

TOOMNYFILES

too many input files specified

   Facility: MONITOR, Monitor Utility

   Explanation: More than 5000 input files were specified on the
   /INPUT qualifier.

   User Action: Reenter the MONITOR request specifying a file
   specification list which identifies no more than 5000 files. For
   performance reasons, it is a good idea to archive or purge MONITOR
   recording files which are unlikely to be used in a multi-file
   summary request.

TOOMNYGST

number of symbol records exceeds count in image header

   Facility: CDU, Command Definition Utility

   Explanation: The input tables have an invalid format or were
   corrupted.

   User Action: Do not use these files again with SET COMMAND.

TOOMNYLIB

too many libraries open

   Facility: LBR, Librarian Subroutine Package

   Explanation: Too many libraries are open. Only 16 libraries may be
   open simultaneously.

   User Action: Use LBR$CLOSE to close any library that you do not
   need to access.

TOOMNYOPND

too many operands for instruction

   Facility: MACRO, VAX MACRO Assembler

   Explanation: Too many operands were specified for the instruction.

   User Action: Reduce the number of operands.

TOOMNYOUT

too many outputs defined

   Facility: CDU, Command Definition Utility

   Explanation: There are too many outputs included in the CLD file.

   User Action: Reduce the number of outputs specified in the CLD
   file.

TOOMNYPSEC

too many PSECTs declared

   Facility: MACRO, VAX MACRO Assembler

   Explanation: More than 255 user-defined program sections were
   declared.

   User Action: Reduce the number of program sections.

TOOMUCHDATA

too much optional or interrupt message data

   Facility: SYSTEM, VMS System Services

   Explanation: A network interrupt message is rejected because it
   contains more than 16 bytes of data.

   On a write request, the DEUNA hardware incorrectly read the value
   for the buffer size because the DEUNA device driver previously
   verified that the buffer size is correct.

   User Action: Repeat the request; do not specify more than 16 bytes
   of data.

   The UNIBUS and UNIBUS Adapter especially the Data Path board,
   should be checked.

TOPLINETRUNC

calculated new first line 'integer', changed to 1

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You adjusted a window. The new first line, however,
   would have been less than 1. Therefore, VAXTPU has truncated it at
   1.

   User Action: None is required. However, you may reexecute the
   built-in procedure ADJUST_WINDOW with arguments that will not
   result in a first line less than 1.

TOQUIT

connection established. Press Ctrl/'escape character' to quit,

   Facility: REM, Set Host Facility

   Explanation: Connection to the remote system has been established.
   This is an informational message. To quit the session, type Ctrl
   /'escape character', and to access DTE command mode, type Ctrl
   /'command character'.

   User Action: None.

TOTAL

'n-records' selected, 'n-records' rejected, 'n' input files

   Facility: ACCOUNTING, Accounting Utility

   Explanation: When the /LOG qualifier is used, this informational
   message displays the total number of records that were selected
   and/or rejected, as well as the total number of input files
   processed.

   User Action: None.

'n' selected, 'n' rejected, 'n' skipped, 'n' input files

   Facility: ERF, Error Log Utility

   Explanation: This message reports the total number of input files
   processed and the total number of entries selected, rejected, and
   skipped across all the files.

   User Action: None.


TRACEBACK

symbolic stack dump follows

   Facility: TRACE, Traceback Facility

   Explanation: This message precedes a symbolic traceback dump.

   User Action: None.

TRACIGN

suppression of traceback overridden by DEBUG specification

   Facility: LINK, Linker Utility

   Explanation: The command line specified both /NOTRACE and /DEBUG.
   /NOTRACE is ignored. The link continues as if /NOTRACE were not
   specified.

   User Action: None.

TRE

error in index tree

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS detected an invalid index pointer in an
   indexed file.

   User Action: Reorganize the file with the CONVERT command.

   This error is caused by hardware errors, VMS RMS or system
   software errors, or inadvertent modifications of files by non-VMS
   RMS programs.

TRMMBX

terminal has associated-terminate image and then SPAWN

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A SPAWN command failed because the current image has
   associated a mailbox with the terminal.

   User Action: Terminate the current image and reenter the SPAWN
   command.

TRMNOTANS

terminal is not ANSI compatible

   Facility: SMG, Screen Management Facility

   Explanation: A call to SMG$GET_PHYSICAL_CURSOR is made specifying
   that the terminal is to be queried to determine where the cursor
   is. This could not be done because the terminal is not ANSI
   standard, and this feature is available only on ANSI terminals.

   User Action: Rerun your application on an ANSI terminal such as a
   VT100.

TRU

truncation

   Facility: STR, String Manipulation Facility

   Explanation: An attempt is made to place more characters into a
   string than it could contain. The value is truncated on the right
   to fit.

   User Action: Do not exceed the maximum string length. This error
   may be ignored if right truncation is acceptable.

TRUNC

data truncated

   Facility: DCX, Data Compression/Expansion Utility

   Explanation: The buffer provided is insufficient to receive the
   compressed data record produced by DCX$COMPRESS_DATA or the
   expanded data record produced by DCX$EXPAND_DATA. As much data
   as the buffer could hold has been returned.

   User Action: Provide a larger buffer.

truncation error in psect 'psect-name' offset 'address' in module
'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A reference using byte or word relative addressing
   mode is too far away.

   User Action: Correct the reference to use longword relative
   addressing mode.


TRUNCATE

line truncated to 'count' characters

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The text you tried to add to a line would extend the
   line beyond its maximum length. Therefore, the additional text is
   truncated to the maximum allowable length of the line.

   User Action: None.

records in 'filename' truncated to 'nnn' bytes

   Facility: SEARCH, SEARCH Command

   Explanation: One or more records in the listed input file were
   too long for SEARCH's internal buffers. The records were shortened
   to the length specified before the SEARCH is performed. This is
   an informational message. The file contains records that exceed
   SEARCH's capacity. The SEARCH is successfully performed on the
   shortened records.

   User Action: None.


TRUNCATED

string too long-truncated

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: DSR encountered a string that is too long. The string
   is truncated.

   User Action: Edit the file and shorten the line.

TRUNCDAT

computed value is 'value1' value written is 'value2' at location
'address'

   Facility: LINK, Linker Utility

   Explanation: This message, which is always issued with the message
   TRUNC, gives more information about the truncation error. The
   variable, 'value1' is the value the linker needed to store;
   'value2' is the value the linker is able to store (a truncated
   version). This error is usually caused when a reference using byte
   or word PC-relative displacement is made to a target requiring
   longword relative displacement.

   User Action: Correct the reference to use longword relative
   addressing mode.

TSTPHSNAM

error obtaining test phase name

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   during initialization. This error is received in relation to a
   previously displayed error condition.

   User Action: Correct the condition leading to this problem and re-
   run the test. If the error persists, submit a Software Performance
   Report.

TTL

text too long: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: The text value for the command (for example, .TITLE,
   .CHAPTER, or .NOTE) is too long for the specified margin setting
   or page size, or it contains excessive use of underlining,
   boldface, or overstriking.

   User Action: Reduce the length of or simplify the text.

TWICE

device 'controller-name'-count changed from 'count' to 'count'

   Facility: SYSGEN, System Generation Utility

   Explanation: A controller name is specified twice for a given
   SYSGEN command CONFIGURE.

   User Action: Verify the value you intend to use.

TWOWIDTHS

the /WIDTH and /LINE_WIDTH qualifiers are redundant
   -/LINE_WIDTH value ignored, /WIDTH value used

   Facility: DIFF, DIFFERENCES Command

   Explanation: You specified both /WIDTH and /LINE_WIDTH; /LINE_
   WIDTH is unnecessary.

   User Action: None.

TYP

error in file type

   Facility: RMS, VMS Record Management Services

   Explanation: The file type specified in a file specification
   contains invalid syntax, for example, more than 39 characters.
   Or the use of a logical name resulted in a duplicate file type
   specification.

   User Action: Correct the syntax of the file specification. Reenter
   the command or correct the program, as necessary.

TYPMISMCH

library type mismatch

   Facility: LBR, Librarian Subroutine Package

   Explanation: This warning message is generated by the Librarian
   routines. On a call to LBR$OPEN, the library type you requested
   conflicts with the library type you specified in the create
   options argument. Processing continues based on the actual library
   type.

   User Action: None.

UAEERR

invalid username, username already exists

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You tried to create a user-record that already exists
   by using the DCL command COPY, ADD, or RENAME.

   User Action: For the new records, enter a user name that does not
   currently exist.

UAFGETERR

error reading user authorization file

   Facility: MAIL, Mail Utility

   Explanation: An error occurred reading the user authorization
   file.

   User Action: Use the VMS RMS status code that accompanies this
   message to determine your action.

UAFOPNERR

error opening user authorization file

   Facility: MAIL, Mail Utility

   Explanation: An error occurred opening the user authorization
   file.

   User Action: Use the VMS RMS status code that accompanies this
   message to determine your action.

UBF

invalid user buffer

   Facility: RMS, VMS Record Management Services

   Explanation: The user record buffer address of the RAB specified
   an area of memory that cannot be written to by the caller.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

UBMAPEXCED

UNIBUS map register allocation exceeded

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UDAPORT

fatal error detected by UDA port driver (PUDRIVER)

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UDEFPSC

attempt to reference undefined psect number 'decimal-number' in
module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: A module referenced an undefined psect.

   User Action: Submit a Software Performance Report on the
   appropriate language processor.

UDF_BKS

cannot convert UDF records into spanned file

   Facility: CONVERT, Convert Utility

   Explanation: UDF records cannot span block boundaries.

   User Action: Specify no block spanning.

UDF_BLK

cannot fit UDF records into single block bucket

   Facility: CONVERT, Convert Utility

   Explanation: The records in the file are longer than 512 bytes (1
   block).

   User Action: Specify a bucket size that is long enough for the
   records.

UDFENV

'undefined environment reference'

   Facility: LINK, Linker Utility

   Explanation: An undefined reference to an environment is
   encountered after Pass 1.

   User Action: Determine why the reference is undefined and correct
   the condition.

UDFSYM

'symbol-name'

   Facility: LINK, Linker Utility

   Explanation: There are strong undefined symbol references after
   Pass 1. This message is output for each undefined symbol.

   User Action: Determine why the symbols are undefined and correct
   the condition.

UDS

undefined symbol: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR has detected an unrecognizable symbol (for
   example, $$name), the name of which is not defined.

   User Action: Remove the symbol.

UICERR

error in UIC specification

   Facility: AUTHORIZE, Authorize Utility

   Explanation: You specified a User Identification Code (UIC)
   incorrectly. User Identification Codes have the format
   [group,member] where the values for group and member may be
   numeric or alphanumeric. The system translates each code into
   a 32-bit octal string; the high-order 16 bits are the group
   identifier, the low- order 16 bits are the member identifier.
   The member identifer must be unique for each system user. In
   a numeric UIC, the group identifier may have an octal value
   between 1 and 37776. The member identifier may have an octal
   value between 0 and 177776. You can omit leading zeros when
   specifying a numeric identifier. In an alphanumeric UIC, the group
   and member identifiers may have between 1 and 31 characters, of
   which at least one must be alphabetic. Alphabetic characters are
   the letters A-Z, and the underscore and dollar sign symbols.

   User Action: Correct the specification of the UIC, according to
   the syntax rules explained above.

UID_INV

resource manager/transaction identifier contains non-hex characters

   Facility: LMCP, Log Manager Control Program

   Explanation: The user has entered a hexadecimal resource
   manager or transaction identifier containing invalid hexadecimal
   characters.

   User Action: Enter the hexadecimal resource manager or transaction
   identifier in the format xxxxxxxx-xxxx-xxxx-xxxxxxxxxxxx, where x
   is a hexadecimal character 0-F.

UID_LENGTH

resource manager/transaction identifier has invalid length

   Facility: LMCP, Log Manager Control Program

   Explanation: The resource manager or transaction identifier
   entered does not satisfy the required length of hexadecimal
   characters. The log identifier should contain 32 hexadecimal
   characters plus four dashes.

   User Action: Enter the resource manager or transaction identifier
   with the correct length using the format xxxxxxxx-xxxx-xxxx-
   xxxxxxxxxxxx, where x is a hexadecimal character 0-F.

UKNFACILITY

unknown facility code specified

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You specified a facility code that does not match any
   established action routine.

   User Action: Establish the facility's action routine before
   attempting to use it.

UME

unmatched end command: 'string'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: An .END command (for example, .END NOTE) is detected,
   but the associated beginning command (.NOTE) is not.

   User Action: Insert the associated beginning command.

UNABLCREVA

unable to create virtual address space

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UNABLE

unable to create file

   Facility: SYSGEN, System Generation Utility

   Explanation: The file specified in the SYSGEN command CREATE
   cannot be created for one of the following reasons:

   o  The device or directory does not exist.

   o  The volume is write-locked or the user does not have write
      access to it.

   o  The volume is full or has insufficient contiguous space to
      complete the request.

   User Action: Correct the situation and reenter the command.

unable to create parameter file

   Facility: SYSGEN, System Generation Utility

   Explanation: The file specified in the SYSGEN command WRITE cannot
   be created for one of the following reasons:

   o  The device or directory does not exist.

   o  The volume is write-locked or the user does not have write
      access.

   o  The volume is full.

   User Action: Correct the situation and reenter the command.

unable to open file

   Facility: SYSGEN, System Generation Utility

   Explanation: The file specified in the SYSGEN command USE cannot
   be found or opened.

   User Action: Reenter the command specifying the correct file
   specification.



UNAOPNHLP

unable to open help library 'filespec'

   Facility: DEBUG, VMS Debugger

   Explanation: The help library 'filespec' cannot be opened to look
   for the help you requested. The accompanying VMS RMS status
   message gives you more information about the reasons for the
   library not being opened.

   User Action: Examine the VMS RMS status message to determine the
   reasons for the help library not being opened, and take action
   based on that information. Also, verify that the logical name
   DBG$HELP is either not defined, or is defined to indicate the
   proper file.

UNAOPNSRC

unable to open source file 'filespec'

   Facility: DEBUG, VMS Debugger

   Explanation: Source lines from the file 'filespec' cannot be
   displayed because the debugger was unable to open the source
   file (represented as 'filespec'). The accompanying VMS RMS status
   message gives more information about the reasons for the source
   file not being opened.

   User Action: Examine the VMS RMS status message to determine
   the reasons for the source file not being opened, and take the
   appropriate action based on that information.

UNAREASRC

unable to read source file 'filespec'

   Facility: DEBUG, VMS Debugger

   Explanation: Source lines from the file 'filespec' cannot be
   displayed because the debugger was unable to read the source
   file (represented as 'filespec'). The accompanying VMS RMS status
   message gives more information about the reasons for the source
   file not being opened.

   User Action: Examine the VMS RMS status message to determine
   the reasons for the source file not being read, and take the
   appropriate action based on that information.

UNARYOPER

operand combination 'operator' 'data-type' unsupported

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The specified operator does not support the specified
   data type.

   User Action: Use only supported data types with the operator.

UNASEFC

unassociated event flag cluster

   Facility: SYSTEM, VMS System Servicesand PTD, Pseudo Terminal

   Explanation: An image called a system service specifying an event
   flag number in a common cluster with which it is not associated.

   User Action: Check for a programming error. Verify the event
   flag numbers specified in system service calls, and verify that
   the required request to associate with the cluster completed
   successfully.

UNDEFINEDPROC

undefined procedure call 'name'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have called an undefined procedure.

   User Action: Check the spelling of the procedure name.

UNDEFLINK

invalid link name

   Facility: LATCP, LAT Control Program

   Explanation: A link has not been created for the specified link
   name.

   User Action: Reenter the command with a valid link name.

UNDEFOUTPUT

line 'line-number': Output parameter/qualifier 'name' is not defined

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an undefined OUTPUT parameter
   /qualifier. All OUTPUT parameters/qualifiers must be previously
   defined.

   User Action: Edit the CLD file so that all OUTPUT parameters
   /qualifiers are defined.

UNDEFSYM

undefined symbol

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A local label is referred to but not defined in a
   local label block; or, if GLOBAL is disabled, a symbol is referred
   to but not defined in the module or specified in an .EXTERNAL
   directive.

   User Action: Define the local label or symbol or specify the
   symbol in an .EXTERNAL directive.

UNDEFSYNTAX

line 'line-number': Syntax 'syntax-name' is not defined

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an undefined syntax name during a
   SYNTAX assignment. All syntax names must be previously defined.

   User Action: Edit the CLD file so that all names in SYNTAX
   assignments are defined.

UNDEFTYPE

line 'line-number': Type 'type-name' is not defined

   Facility: CDU, Command Definition Utility

   Explanation: CDU encountered an undefined type name during a TYPE
   assignment. All type names must be previously defined.

   User Action: Edit the CLD file so that all names in TYPE
   assignments are defined.

UNDEFXFRAD

undefined transfer address

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The .END directive specified a transfer address
   that is not defined in the module or specified in an .EXTERNAL
   directive.

   User Action: Define the transfer address or delete it from the
   .END directive.

UNDEXP

undefined exponentiation User PC 'location'

   Facility: MTH, Mathematics Facility

   Explanation: An expression contained exponentiation that cannot be
   mathematically evaluated, for example, 0.**0. The result is the
   reserved operand, minus zero.

   User Action: Use the traceback information or the PC displayed in
   the message to locate the error in your program and correct the
   math expression.

UNDFIL

file has been not opened by DCL-check logical name

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A DCL command READ, WRITE, or CLOSE specified a
   file that is not currently opened or for which no logical name
   is assigned.

   User Action: Reenter the command; specify the name of an opened
   file. Or use the DCL command OPEN to open the file before
   attempting to read or write it.

UNDKEY

'state' key 'key-name' is undefined

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: You attempted to use the SHOW/KEY or the DELETE/KEY
   command to show or delete the definition of a key that is not
   defined.

   User Action: None.

UNDOPTION

undefined option flag is set

   Facility: SORT, Sort/Merge Utility

   Explanation: You can set only those option flags used by SORT
   /MERGE. All other bits in the longword are reserved and must be
   zero.

   User Action: Correct your specification file.

UNDSYM

undefined symbol-check validity and spelling

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A character string beginning with an alphabetic
   character is encountered in a context where the command
   interpreter evaluates expressions and automatically attempts
   symbol substitution. The character string is not defined as a
   local symbol for the current command level or as a global symbol.

   User Action: Verify that the symbol is defined and reenter the
   command. If the error occurred in a command procedure, correct
   the procedure to ensure that the symbol is defined locally or
   globally, as required before the statement that caused the error.

UNDTERNAM

undefined terminal name

   Facility: SMG, Screen Management Facility

   Explanation: The requested terminal definition is not found in the
   caller's private copy of Termtable or the system copy Termtable.

   User Action: If you intended to use a private terminal definition,
   make sure that TERMTABLE.EXE exists in your private directory and
   that the logical name TERM$TABLOC points to it. If you expected
   your terminal to be defined in the system Termtable, check with
   your system manager.

UNDTERNOP

undefined terminal-couldn't access private terminal table

   Facility: SMG, Screen Management Facility

   Explanation: The requested terminal definition is not found in the
   caller's private copy of Termtable or the system Termtable. The
   caller's private Termtable could not be accessed, either because
   it did not exist or because RMS could not open the file.

   User Action: If you intended to use a definition from your private
   Termtable, make sure that TERMTABLE.EXE exists in your private
   directory and that the logical name TERM$TABLOC points to it. Make
   sure that you have read access to the file.

UNDTERNOS

undefined terminal-couldn't access system terminal tables

   Facility: SMG, Screen Management Facility

   Explanation: The requested terminal definition is not found in
   the caller's private Termtable or the system Termtable. The system
   Termtable is unavailable.

   User Action: The system Termtable should be mapped as a global
   section and therefore should always be available. Consult your
   system manager.

UNDTERTYP

undefined terminal type

   Facility: SMG, Screen Management Facility

   Explanation: The definition for the requested terminal type is
   not found in the caller's private copy of Termtable or the system
   Termtable.

   User Action: If you intended to use a private definition, make
   sure that TERMTABLE.EXE exists in your private directory and that
   the logical name TERM$TABLOC points to it. If you expected your
   terminal definition to exist in the system Termtable, consult your
   system manager.

UNDWIDCLA

undefined widget class specified

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A widget class integer that is not known to VAXTPU
   was specified to the CREATE_WIDGET built-in procedure.

   User Action: Define a widget class using the DEFINE_WIDGET_CLASS
   built-in procedure before attempting to call CREATE_WIDGET.

UNECLIERR

unexpected CLI error

   Facility: LIB, Library Facility

   Explanation: The CLI returned an error status that is not
   recognized. This error could be caused by use of a nonstandard
   CLI.

   User Action: If this error occurs while using the DCL Command
   Language Interpreter, submit a Software Performance Report (SPR).

Unexpected characters after end of command

   Facility: EDT, EDT Editor

   Explanation: The command you entered ends with a string of one or
   more characters that is not part of the command. The rest of the
   command is valid.

   User Action: Reenter the command removing the invalid characters
   from the end of the command line.

UNEXPECTED

installation terminated due to unexpected event.

   Facility: VMSINSTAL, Install Procedures

   Explanation: An unexpected event has ended the installation of
   VMSINSTAL. See accompanying messages for more information.

   User Action: If you can determine and resolve the problem,
   reinstall the product. Otherwise, contact your DIGITAL field
   service representative.

Unexpected Interrupt-CNF/PMC/PSR 'xxxxxxxx/xxxxxxxx/xxxxxxxx'

   Facility: VAXport, VAXport Driver

   Explanation: The port driver attempts to reinitialize the port;
   after 50 failed attempts, it marks the device off line.

   User Action: Call DIGITAL field service to check the port
   hardware.

UNEXPERR

unexpected exception

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: A hardware exception occurred during bootstrap
   execution.

   User Action: Run diagnostics to check for hardware errors.

unexpected interrupt

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: An unknown interrupt occurred during bootstrap
   execution.

   User Action: Try the operations again. If the problem persists,
   run diagnostics to check for hardware errors.

unexpected error

   Facility: MONITOR, Monitor Utility

   Explanation: An unexpected hardware or software error condition
   occurred. To obtain more information, examine the accompanying
   linked message.

   User Action: Correct the condition causing the failure, if
   possible, and reenter the MONITOR request. Otherwise, submit a
   Software Performance Report (SPR).



UNEXPEXC

A debugger exception handler is called during program execution this
debugging session may not be reliable

   Facility: DEBUG, VMS Debugger

   Explanation: This error can occur if the debugger is running and
   an exception is signaled in one of the program's exit handlers;
   either a CTRL/Y EXIT operation is performed, or a Force Exit
   system service call ($FORCEX) is issued on behalf of the process.

   User Action: Identify and correct the error in the user program.
   If the debugger reports this error under circumstances other than
   those described, then submit a Software Performance Report (SPR).

UNEXPIOINT

unexpected UNIBUS adapter interrupt

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UNINITVAR

uninitialized variable

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have tried to use an unspecified variable.

   User Action: Check the spelling of the variable. You may assign a
   value to the variable by placing it on the left-hand side of an
   assignment statement.

UNIVSTAR

UNIVERSAL=* option is ignored unless /NOEXECUTABLE specified

   Facility: LINK, Linker Utility

   Explanation: The UNIVERSAL=* option has been specified in the
   options file when producing a shareable image output file. This
   option is no longer valid when producing image files, although
   it is accepted when generating only a symbol table (.STB) output
   file.

   User Action: If you desire a shareable image output file, then
   you must specify all universal symbols explicitly. Otherwise, if
   you only need a symbol table file, then specify /NOEXECUTABLE to
   suppress image file output.

UNKADAP

unknown adapter type encountered

   Facility: SYSGEN, System Generation Utility

   Explanation: An internal error occurred when SYSGEN tried to parse
   an adapter name.

   User Action: Check the command line entered.

UNKCLASS

unknown device class found, 'device-class-value'

   Facility: ERF, Error Log Utility

   Explanation: An entry with an unknown or unsupported device class
   is encountered.

   User Action: Use the UNKNOWN_ENTRIES keyword with the /INCLUDE
   qualifier to obtain the Report (SPR).

UNKCPU

unknown or unsupported processor

   Facility: VAXCLUSTER, VAXcluster Facility

   Explanation: The system is not supported as a satellite node with
   this version of the VMS operating system.

   User Action: Refer to the VMS Software Product Description (SPD)
   for supported configurations for VAXclusters and check which
   versions of the VMS operating system support your processor.

unknown CPU type encountered

   Facility: SYSGEN, System Generation Utility

   Explanation: You specified an unknown CPU type with the SYSGEN
   command SHOW/ADAPTER.

   User Action: Retry specifying a different CPU type.


UNKDEV

unknown device type

   Facility: INIT, INITIALIZE Command and MOUNT, Mount Utility

   Explanation: The device type specified is unknown or invalid.

   User Action: Verify the device name (or logical name if a logical
   name is specified), and reenter the command with the correct
   device name.

UNKENTRY

unknown entry type, 'entry-type value'

   Facility: ERF, Error Log Utility

   Explanation: An entry with an unknown or unsupported entry type is
   encountered.

   User Action: Use the UNKNOWN_ENTRIES keyword with the /INCLUDE
   qualifier to obtain the Report (SPR).

UNKESCAPE

unknown escape sequence read

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: TPU does not know how to process the escape sequence.

   User Action: Use only supported terminals with TPU.

UNKESCSEQ

unknown escape sequence received from DECtalk

   Facility: DTK, DECtalk Facility

   Explanation: You passed an escape sequence to a DTK$ input routine
   that it is unable to understand.

   User Action: Submit a Software Performance Report (SPR).

UNKKEYWORD

an unknown keyword has been used as an argument

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You have specified an unrecognizable item in place of
   a valid keyword.

   User Action: Execute the built-in procedure SHOW (KEYWORDS) for a
   list of valid keywords.

UNKMSG

unknown message header type

   Facility: REM, Set Host Facility

   Explanation: A system internal error has occurred.

   User Action: Submit a Software Performance Report (SPR).

UNKNFAIL

internal VAXTPU failure, unknown reason

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal error occurred in the VAXTPU software.

   User Action: Submit a Software Performance Report (SPR).

UNKNOPR

unknown operator

   Facility: OPCOM, Operator Communication

   Explanation: A DCL command REQUEST or REPLY specified an invalid
   operator name; the keyword is invalid. No request message is sent.

   User Action: Reenter the DCL command REQUEST or REPLY and specify
   a valid operator name.

UNKNOWNCLEARINGHOUSE

the clearinghouse does not exist

   Facility: DNS, Distributed Name Service Clerk Service

   Explanation: The DNS clerk attempted to contact a clearinghouse
   that does not exist in the namespace. This can occur when the DNS
   clerk caches are out of date or when the replica set of a given
   directory is out of date.

   User Action: None. The DNS clerk will try to contact other
   clearinghouses to satisfy the request.

UNKNOWN_TAG

'reference-string' is an unknown tag in statement 'number'

   Facility: FDL, Create/FDL Utility

   Explanation: No value or an incorrect value was used for the
   STORED_SEMANTICS secondary attribute.

   User Action: Use the correct value.

UNKNPRQ

unknown Inter-processor Request Message

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UNKOBJECT

unknown object in SMI call

   Facility: SMI, System Management Intergator/Server

   Explanation: This message indicates an internal error. The server
   does not recognize the object.

   User Action: Ensure that all the nodes in the environment contain
   the correct versions of SMISERVER and SYSMAN. If no problems
   are found, submit a Software Performance Report with the exact
   sequence of SYSMAN commands leading to the error.

UNKOPCODE

unknown opcode

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal error occurred in the VAXTPU software.

   User Action: Submit a Software Performance Report (SPR).

UNKPKTFMT

unknown packet format, entry 'number' skipped

   Facility: ERF, Error Log Utility

   Explanation: An entry with an unknown or unsupported record format
   was encountered.

   User Action: Submit a Software Performance Report (SPR).

UNKREPLY

unknown reply received from DECtalk

   Facility: DTK, DECtalk Facility

   Explanation: You passed an escape sequence to a DTK$ input routine
   that it could not parse correctly.

   User Action: Submit a Software Performance Report (SPR).

UNKRSTRT

unknown restart code

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UNKTYPE

unknown data type

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal error occurred in the VAXTPU software.

   User Action: Submit a Software Performance Report (SPR).

unknown device type, 'device-type value'

   Facility: ERF, Error Log Utility

   Explanation: An entry with an unknown or unsupported device type
   is encountered.

   User Action: Use the UNKNOWN_ENTRIES keyword with the /INCLUDE
   qualifier to obtain the Report (SPR).


UNKWNDESC

unknown descriptor type

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: A descriptor in the descriptor array has an unknown
   data type.

   User Action: Use a valid data type.

UNLKVOL

error unlocking volume set

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during
   an attempt to unlock the volume set to allow allocation. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error, then
   dismount and remount the volume set.

UNLOCKED

'filename' unlocked

   Facility: SET, SET Facility

   Explanation: The file has been successfully unlocked.

   User Action: None.

'filespec' unlocked

   Facility: Shared by several facilities

   Explanation: The file specified by a DCL command UNLOCK is
   unlocked.

   User Action: None.


UNLOCKERR

error unlocking 'filename'

   Facility: SET, SET Facility

   Explanation: An error occurred when the file is being unlocked.
   This message is issued with an accompanying message.

   User Action: Take corrective action based on the accompanying
   message.

UNMTCHPARN

unmatched left parenthesis found

   Facility: DEBUG, VMS Debugger

   Explanation: A left parenthesis (()  does not have a matching
   right parenthesis ()).

   User Action: Include the right parenthesis ( )).

UNPRIKW

unrecognized primary keyword in statement 'number'<CRLF>' reference-
text'

   Facility: FDL, Create/FDL Utility, FDL, Edit/FDL Utility

   Explanation: A keyword was misspelled.

   User Action: Edit the FDL file to correct the spelling and try
   again.

UNPROPARM

unprocessed parameters

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A command contained more parameters than are
   currently supported.

   User Action: Reenter the command; specify only the maximum number
   of parameters.

UNPROQUAL

unprocessed qualifiers

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The message indicates that qualifiers present with
   the command were ignored. The operating system does not normally
   display this message.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

   If either the /SHOW or the /CROSS_REFERENCE qualifier is specified
   without /LIST, reenter the command with the /LIST qualifier.

unprocessed qualifiers

   Facility: CLI, Command Language Interpreter (DCL) and MACRO, VAX
   MACRO Assembler

   Explanation: This message is associated with a status code
   returned from the command interpreter's result parse routine.
   The message indicates that qualifiers present with the command
   were ignored. The operating system does not normally display this
   message.

   If this error occurred as a result of a macro assembler operation
   either the /SHOW or the /CROSS_REFERENCE qualifier is specified
   without the /LIST qualifier. The MACRO assembler does not process
   the source file or produce an object module.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

   If either the /SHOW or the /CROSS_REFERENCE qualifier is specified
   without /LIST, reenter the command with the /LIST qualifier.


UNQUAKW

unrecognized qualifier keyword in statement
'number'<CRLF>'reference-text'

   Facility: FDL, Create/FDL Utility, FDL, Edit/FDL Utility

   Explanation: A keyword was misspelled.

   User Action: Edit the FDL file to correct the spelling and try
   again.

UNRCMD

unrecognized command 'command'

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The command entered is not a valid SHOW CLUSTER
   command.

   User Action: Enter a valid command or enter the HELP command for a
   list of valid commands.

UNRCMP

unrecognized component 'text'

   Facility: NCP, Network Control Program

   Explanation: A component is not known to the node. The 'text' part
   of this message contains the component identification.

   User Action: Review the command description and reenter your
   command with the correct component.

UNREACHABLE

remote node is not currently reachable

   Facility: SYSTEM, VMS System Services

   Explanation: An attempt is made to initiate a DECnet-VAX logical
   link connection. The specified node exceeded routing requirements,
   that is, the path to the node contains too many intermediate
   nodes.

   User Action: This condition will persist until there is a change
   in the network topology. Notify your system manager. Refer to the
   VMS Networking Manual for additional information.

unreachable code

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: This code will never be executed. The compiler might
   remove this code to optimize performance.

   User Action: Remove the unreachable code.


Unrecognized command

   Facility: EDT, EDT Editor

   Explanation: EDT does not recognize or support the command
   entered. The command may have been incorrectly specified.

   User Action: Check the command syntax and reenter the command.

Unrecognized command option

   Facility: EDT, EDT Editor

   Explanation: The command you entered includes an invalid option
   /qualifier.

   User Action: Reenter the command specifying a valid option
   /qualifier.

Unrecognized SCA Packet

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver closes the port-to-port virtual
   circuit to the remote port. If the virtual circuit is already
   closed, the port driver inhibits datagram reception from the
   remote port.

   User Action: Submit a Software Performance Report, including the
   error log file that contains this entry and the crash dumps from
   both the local and remote systems.

UNRECSTA

unrecognized statement

   Facility: SMG, Screen Management Facility

   Explanation: The Termtable compiler encountered a statement that
   it does not recognize.

   User Action: Check your definition. Make sure you have spelled
   keywords correctly and that statements appear only in valid
   sequences.

UNRECSTMT

unrecognized statement

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The operator is not an opcode, directive, user-
   defined opcode, previously defined macro, or macro in a library.

   User Action: Change the operator to a valid opcode, directive, or
   macro; or define the macro.

UNRELVOL

volume is not part of volume set being mounted

   Facility: MOUNT, Mount Utility

   Explanation: You specified a volume to be mounted that is not part
   of a volume set.

   User Action: Either mount the specified volume separately or
   specify the /BIND qualifier with the DCL command MOUNT.

UNRFORCOD

unrecognized format code

   Facility: LIB, Library Facility

   Explanation: Unrecognized format code

   User Action: Examine the format string for invalid format code.
   The format string may be supplied in the logical name or it can be
   hard-coded.

UNRFUN

unrecognized function or option

   Facility: NCP, Network Control Program

   Explanation: Either the verb or component requested a feature that
   is unsupported or is unrecognized.

   User Action: Consult the documentation for the supported functions
   and operations.

UNRKEY

keyword is an unrecognized keyword

   Facility: LIB, Library Facility

   Explanation: This message is associated with a status code
   returned from the Run-Time Library. The indicated keyword is not
   recognized.

   User Action: Correct the program and specify a valid keyword.

unrecognized field or class name 'class-name'

   Facility: SHOW CLUSTER, Show Cluster Utility

   Explanation: The field or class name entered is not valid in any
   Report (SPR).

   User Action: Enter a valid field or class name, or enter the HELP
   FIELDS or HELP CLASSES command for a list of valid field or class
   names.


UNRPTY

unrecognized parameter type 'text'

   Facility: NCP, Network Control Program

   Explanation: A parameter type specified in your command is
   incorrect and therefore unrecognizable by the network management
   software. The 'text' part of the message identifies the
   unrecognizable parameter.

   User Action: Review the command description and reenter your
   command with the correct parameter.

UNSAFE

drive unsafe

   Facility: SYSTEM, VMS System Services

   Explanation: The drive malfunctioned and cannot be used.

   User Action: Check the status of the device and repeat the
   request. If the failure persists, notify the system manager.

UNSECKW

unrecognized secondary keyword in statement
'number'<CRLF>'reference-text'

   Facility: FDL, Create/FDL Utility, FDL, Edit/FDL Utility

   Explanation: A keyword was mispelled.

   User Action: Edit the FDL file to correct the spelling and try
   again.

UNSOLICIT

response not solicited

   Facility: SYSTEM, VMS System Services

   Explanation: A message is received that is not requested from a
   local process. This may be an information exception or a control
   message from a remote user.

   User Action: Process the message

UNSTLEV

the /INPUT qualifier file has an unsupported MONITOR file structure level

   Facility: MONITOR, Monitor Utility

   Explanation: The input recording file is a valid MONITOR file with
   a file structure that is not supported by the current version of
   MONITOR.

   User Action: Use the monitor convert command to update the
   recording file to the current structure level.

UNSUPRTCPU

unsupported CPU

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UNSVRS

version of listener on executor is not supported

   Facility: NCP, Network Control Program

   Explanation: The network management listener (NML) did not respond
   with a valid version number. The executor cannot be accessed by
   network management.

   User Action: None. You cannot connect to the node until it is
   upgraded to a supported version.

UNTERMARG

unterminated argument

   Facility: MACRO, VAX MACRO Assembler

   Explanation: The string argument is missing a delimiter or the
   macro argument is missing an angle bracket.

   User Action: Add a delimiter or an angle bracket to the string
   argument.

UNTERMCOND

unterminated conditional

   Facility: MACRO, VAX MACRO Assembler

   Explanation: A conditional assembly block is not terminated by the
   .ENDC directive. The assembler inserted the .ENDC directive before
   the .END directive.

   User Action: Add the .ENDC directive to the conditional assembly
   block.

UNWIND

unwind currently in progress

   Facility: SYSTEM, VMS System Services

   Explanation: This status code is used as a call argument for
   condition handlers called during the search of the call stack
   during an unwind operation. The operating system does not normally
   display this message.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

UNWINDING

unwind already in progress

   Facility: SYSTEM, VMS System Services

   Explanation: A condition handler is called during an unwind
   operation and attempted to issue an unwind request. The operating
   system does not normally display this message.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

UNXINTEXC

unexpected interrupt or exception

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UNXPCTSTS

unexpected status detected. Expected 'status'. Found:

   Facility: Shared by several facilities

   Explanation: An error is detected by a system service. A
   subsequent message explains the reason for the error.

   User Action: See the description of the accompanying VMS RMS
   message in this manual.

UNXSIGNAL

unexpected signal name in ACP

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

UPDATE

patch with eco level 'nn' ignored due to update qualifier

   Facility: PATCH, Patch Utility

   Explanation: The Patch Utility ignored the patch associated with
   this ECO level because you used the /UPDATE qualifier and did not
   include this particular ECO level in the qualifier's value list.

   User Action: Add the ECO level to the qualifier's value list;
   retry if you want this ECO to be applied.

UPDATED

file 'filename' is already updated.

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL is attempting to update a system text file,
   but the file has already been updated successfully.

   User Action: None.

UPDURTRAV

index update during traverse illegal

   Facility: LBR, Librarian Subroutine Package

   Explanation: The routine that you specify in the routine-
   name argument cannot contain any calls to either LBR$DELETE or
   LBR$INSERT_KEY.

   User Action: Remove any embedded calls to either LBR$DELETE or
   LBR$INSERT_KEY before calling the routine.

UPI

UPI not set when sharing and BIO or BRO set

   Facility: RMS, VMS Record Management Services

   Explanation: VMS RMS permits file sharing when block I/O access
   (BIO or BRO) is specified and the file-sharing option UPI is
   specified also. The user program must provide all required
   interlocks.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

URE

unrecoverable error processing record 'ln' on page 'pn' of input
file 'filename'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: An irrecoverable I/O error occurred, terminating the
   processing at the specified edit line (ln) and page number (pn) of
   the input file. This is a DSR internal error.

   User Action: Submit a Software Performance Report (SPR).

URR

unrecognized request: 'n'

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: DSR detected an unrecognizable internal failure
   request. This indicates DSR internal error.

   User Action: Reprocess the file. If the error occurs again, submit
   a Software Performance Report (SPR).

USCALL

target of CALL not found-check spelling and presence of label

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The destination label of a CALL statement could not
   be found. To be a valid destination, the label must be followed by
   the SUBROUTINE statement.

   User Action: Make sure that the CALL statement in your command
   procedure is using the correct label, or that the subroutine label
   exists and is followed by the SUBROUTINE statement.

USEANS

auto-answer file will be used.

   Facility: VMSINSTAL, Install Procedures

   Explanation: You specified the auto-answer option when you started
   VMSINSTAL. The recorded answers will be used for the installation.

   User Action: You do not have to answer prompts and questions
   displayed by the product. If you want to record new answers,
   delete the answer file and install the product with the auto-
   answer option.

USEFLORES

use of floating reserved operand

   Facility: OTS, General Purpose Facility and LIB, Library Facility

   Explanation: A program accessed a reserved floating operand. This
   message is associated with a status code returned by the Run-Time
   Library.

   User Action: Use the traceback information to locate the statement
   that caused the error and correct your program.

USERDSABL

user 'username' cannot receive new mail

   Facility: MAIL, Mail Utility

   Explanation: You have attempted to send mail to a user who has
   been disallowed from receiving mail.

   User Action: None.

USERQST

request 'number' from user 'user-name'

   Facility: OPCOM, Operator Communication

   Explanation: This is a user message to the operator; a response is
   required.

   User Action: Wait for the operator response.

USERSPEC

invalid user specification 'user-name'

   Facility: MAIL, Mail Utility

   Explanation: While sending a mail message to a list of users, you
   specified an invalid user name.

   User Action: Ensure that your list contains valid user names and
   retry the operation.

USERVAL

user validation error

   Facility: INPSMB, Input Symbiont

   Explanation: The user name and password specified in a batch
   job entered from a card reader are not authorized on the system
   according to the user authorization file.

   User Action: Consult your system manager.

USEUDFEN2

undefined environment number 'number' referenced in psect 'string'
offset 'hexadecimal-number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An undefined environment is referenced in a module.

   User Action: Ensure that all referenced environments are defined.

USEUDFENV

undefined environment 'string' referenced in psect 'string' offset
'hexadecimal-number' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An undefined environment is referenced in a module.

   User Action: Ensure that all referenced environments are defined.

USEUDFLSY

undefined module-local symbol 'symbol name' referenced in psect
'string' offset 'hexadecimal-number' in module 'module-name' file
'filename'

   Facility: LINK, Linker Utility

   Explanation: An undefined module-local symbol is referenced in a
   module.

   User Action: Ensure that all referenced module-local symbols are
   defined.

USEUNDEF

undefined symbol 'symbol-name' referenced in psect 'psect-name'
offset 'address' in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An undefined symbol is referenced in a module.

   User Action: Define the symbol.

USEUNDEF2

undefined symbol 'symbol-name' referenced in debug or traceback
record in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: An undefined symbol is referenced in a debug or
   traceback record.

   User Action: Define the symbol.

USGOSUB

target of GOSUB not found-check spelling and presence of label

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The destination label of a GOSUB statement could not
   be found.

   User Action: Make sure that the GOSUB statement in your command
   procedure is using the correct label, or that the subroutine label
   exists.

USGOTO

target of GOTO not found-check spelling and presence of label

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: The label of a GOTO command could not be found in the
   current command file.

   User Action: Correct the command file by ensuring that the correct
   label exists.

USRINPERR

user input routine returned error status

   Facility: LBR, Librarian Subroutine Package

   Explanation: A user-supplied input routine returned a nonsuccess
   status to LBR$OUTPUT_HELP.

   User Action: Determine the reason for the failure in the input
   routine.

USRTFR

image 'image-name' has no user transfer address

   Facility: LINK, Linker Utility

   Explanation: An executable image does not contain a transfer
   address.

   User Action: Define a transfer address for the image.

USZ

invalid user buffer size

   Facility: RMS, VMS Record Management Services

   Explanation: The size specified in the user record buffer size
   field is invalid. The buffer size must be in the range of 1 to
   65,535.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

V2COMP

parameter not applicable on V2.0 DECnet executor node

   Facility: NCP, Network Control Program

   Explanation: A given request could not be converted into a
   Version 2.0 NICE message when connected to a Version 2.0 network
   management listener (NML).

   User Action: Remove the invalid parameter from the command line.

VALERR

specified value is out of legal range

   Facility: DSR, DIGITAL Standard Runoff

   Explanation: A value is specified that is outside the range for
   valid values.

   User Action: Make sure that the value is within the range.

specified value is out of legal range

   Facility: Shared by several facilities

   Explanation: A value is specified which is not within legal range.

   User Action: Respecify a value within legal range.


VALNOTADDR

value of variable 'symbol-name' not usable as address

   Facility: DEBUG, VMS Debugger

   Explanation: The value of the specified variable is not usable as
   an address. The address must be a longword.

   User Action: Modify the address and retry the operation.

VALPRI

value required on primary in statement 'number'

   Facility: FDL, Create/FDL Utility, FDL, Edit/FDL Utility

   Explanation: A primary was specified that requires a value, but
   none was given.

   User Action: Supply a value for the primary.

VALREQ

missing qualifier or keyword value-supply all required values

   Facility: CLI, Command Language Interpreter (DCL)

   Explanation: A value must be specified for the qualifier or
   keyword.

   User Action: Reenter the command and supply a value to the
   qualifier or keyword.

VALTOOBIG

value too large for field

   Facility: AUTHORIZE, Authorize Utility

   Explanation: The value you specified for a qualifier is too large.

   User Action: See the VMS Authorize Utility Manual for information
   about qualifier value sizes. Enter a smaller value for the
   qualifier.

VALUE

set to maximum

   Facility: SYSGEN, System Generation Utility

   Explanation: A SYSGEN command SET is entered to set a parameter
   to a value that is greater than the allowable maximum. The SYSGEN
   utility reduces the value to the allowable maximum.

   User Action: None.

set to minimum

   Facility: SYSGEN, System Generation Utility

   Explanation: A SYSGEN command SET is entered to set a parameter
   to a value that is less than the allowable minimum. The SYSGEN
   utility increases the value to the permissible minimum.

   User Action: None.


VARITH

vector arithmetic fault, summary=xx, mask=xx, PC=location,
PSL=xxxxxxxx

   Facility: SYSTEM, VMS System Services

   Explanation: A vector operate instruction, executing within
   the context of the current context, has resulted in a vector
   arithmetic trap. The message indicates an exception condition
   and is followed by a register and stack dump to help locate the
   error.

   The summary item is a longword mask, the bits of which, when set,
   signify the following vector arithmetic exception conditions:

   o  Bit 0 = floating underflow

   o  Bit 1 = floating divide by zero

   o  Bit 2 = floating reserved operand

   o  Bit 3 = floating overflow

   o  Bit 5 = integer overflow

   The mask item is a longword, the bits of which (0 through 15)
   correspond to the VAX vector registers (V0 through V15). When set,
   a bit indicates that an element of the associated vector register
   was involved in an operation that caused one or more of the vector
   arithemetic exceptions reported in the summary item.

   The message also includes the Program counter (PC) of the vector
   instruction which caused the exception to be reported (note that
   this instruction is not always that that caused the exception),
   and the processor status longword (PSL) at the time the exception
   was reported.

   User Action:

   One or more of the following debugging strategies may help you
   determine which calculations resulted in the reported error or
   errors:

   o  Recompile the source with the /DEBUG, /NOVECTOR, /CHECK=BOUNDS
      qualifiers; relink using the /DEBUG and /MAP qualifiers; and
      run the resulting scalar image with the /DEBUG qualifier. A
      scalar arithmetic exception should occur at the calculation
      that caused the original vector arithmetic exception.

   o  Recompile the source using the /DEBUG, /LIST, and /VECTOR
      qualifiers; relink using the /DEBUG and /MAP qualifiers; and
      run the resulting image with the /DEBUG qualifier. Use the
      SET VECTOR_MODE SYNCHRONIZED or the SYNCHRONIZE VECTOR_MODE
      debugger command to guarantee that all exceptions resulting
      from vector operations be delivered before the execution of the
      next scalar instruction. Step through the program, inspecting
      the contents of those vector registers that are involved in
      each vector operation.

      When a vector operate instruction causes an floating-point
      exception in a vector element, the exception result is encoded
      into the corresponding element of the destination register.
      When the destination vector register is the target of an
      EXAMINE/FLOAT debugger command, the debugger displays the
      decoded exception message in the associated vector element.

      When a vector operate instruction causes an integer overflow in
      a vector element, the corresponding element of the destination
      register contains a value that is larger than 32 bits. When
      the destination vector register is the target of an EXAMINE
      debugger command, inspect each element for a value larger than
      2[32].

VASFUL

virtual address space is full

   Facility: SYSTEM, VMS System Services

   Explanation: The virtual address space is full.

   User Action: Reboot and increase the amount of allowable virtual
   address space. If this message is associated with a vector
   disabled (VECDIS) status code, insufficient process virtual
   address space exists to allow the current process's mainline
   vector state to be saved.

VASOVF

system virtual address space limit exceeded

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The combination of SYSGEN parameters used to specify
   various capacities within the operating system have pushed the
   size of the operating system address space over the limit allowed
   by the VAX architecture.

   User Action: Reduce one or more parameters which contribute to
   the virtual address space size required by VMS: VIRTUALPAGECNT,
   BALSETCNT. By using AUTOGEN to set these values for your system,
   you will avoid selection of parameter combinations that cause
   system space to overflow its architectural boundaries.

VAXport is going off line

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver halts port operations.

   User Action: Restore power to the port hardware.

VAXport is reinitializing

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport reinitializes the port and restarts port
   operations.

   User Action: None.

VBNERROR

'filespec' has duplicate blocks 'n' through 'n'

   Facility: BACKUP, Backup Utility

   Explanation: The specified blocks of the specified file were
   present more than once in the input save set. Data in the save
   set may be corrupted.

   User Action: Examine the file for corruption and reconstruct
   as necessary. If this error occurs during a disk-to-disk (copy)
   operation, it indicates a software error in the Backup Utility; in
   this case, submit a Software Performance Report (SPR).

VBNMAPFAIL

virtual block map failure

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

VBNMISSING

'filespec' has missing blocks 'n' through 'n'

   Facility: BACKUP, Backup Utility

   Explanation: The specified blocks of the specified file were
   missing from the input save set. Data in the blocks is lost.

   User Action: Examine the file for corruption and reconstruct
   as necessary. If this error occurs during a disk-to-disk (copy)
   operation, it indicates a software error in the Backup Utility; in
   this case, submit a Software Performance Report (SPR).

VBNPASTEOF

'filespec' has blocks 'n' through 'n' past end of file

   Facility: BACKUP, Backup Utility

   Explanation: The specified blocks of the specified file were
   present in the input save set although they follow the end of
   file block. Data in the save set may be corrupted.

   User Action: Examine the file for corruption and reconstruct
   as necessary. If this error occurs during a disk-to-disk (copy)
   operation, it indicates a software error in the Backup Utility; in
   this case, submit a Software Performance Report (SPR).

VCALNORCV

expected vector alignment exception not received

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered a
   hardware error while testing a vector processor's ability to
   generate memory management exceptions.

   User Action: Run diagnostics for VAX Vectors, or contact Digital
   customer service.

VECALIGN

access violation, reason mask = xx, virtual address = location, PC =
location, PSL = xxxxxxx

   Facility: SYSTEM, VMS System Services

   Explanation: The current process has issued a VAX vector
   memory access instruction that has attempted an operation on an
   improperly-aligned vector element.

   The VAX architecture requires that vector operands to vector
   memory access instructions be naturally aligned in memory.
   Longwords must be aligned on longword boundaries; quadwords must
   be aligned on quadword boundaries.

   This message indicates an exception condition and is followed by
   a register and stack dump to help locate the error. The reason
   mask is a longword whose lowest three bits, if set, indicate that
   the instruction caused a length violation (bit 0), referenced the
   process page table (bit 1), attempted a read/modify operation (bit
   2), was a vector operation on an improperly-aligned vector element
   (bit 3, always set), or was a vector instruction reference to an
   I/O space address (bit 4).

   User Action: Examine the PC and virtual address displayed in the
   message. The virtual address is an address in the same page as
   that address to which the access was attempted. Check the program
   listing to verify that the vector operands to vector memory
   instructions are naturally aligned.

VECCTXERR

error encountered during vector context testing

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test encountered an error
   initiating vector context testing. This error is received in
   relation to a previously displayed error condition or might be
   due to a vector hardware problem.

   User Action: If the condition causing the problem can be
   identified, correct the condition and re-run the test. If the
   error persists, submit a Software Performance Report. If no
   condition can be identified, run diagnostics for VAX Vectors or
   contact your Digital customer service.

VECDIS

vector disabled fault, code=xx, PC = location, PSL = xxxxxxx

   Facility: SYSTEM, VMS System Services

   Explanation: The current process has issued a vector instruction
   which requires that an idle vector processor become active. Under
   normal circumstances, this event is not reported to a system user.
   However, if the vector processor was originally disabled due to
   some error involving the current process, the VECDIS message is
   issued in association with one of the following messages:

   o  BADCONTEXT-The vector state of the mainline routine is corrupt
      and cannot be restored.

   o  CPUNOTACT-The VAX system contains no vector-present processor
      on which to schedule the current process.

   o  EXQUOTA-The VMS operating system cannot allocate sufficient
      space to save the vector state of the mainline routine because
      the process in which the routine is executing has exceeded
      process paging file quota.

   o  INSFMEM-Insufficient nonpaged dynamic memory exists to turn the
      current process into a vector consumer.

   o  INSFWSL- The VMS operating system cannot allocate sufficient
      space to save the vector state of the mainline routine because
      the working set limit of the process in which the routine is
      executing is too low.

   o  MCHECK-The vector processor has been disabled due to the
      detection of a hardware errort.

   o  NOPRIV-An ACL on the vector capability has denied a user mode
      program access to the vector processor.

   o  VASFUL-The VMS operating system cannot allocate sufficient
      space to save the vector state of the mainline routine because
      the address space (P0 space) of the process in which the
      routine is executing is full.

   User Action: See the description of the associated status code for
   additional information on the error.

VECEMULTR

testing to be performed on vector emulator

   Facility: UETP, User Environment Test Package

   Explanation: No vector processors were found on the system but the
   vector emulator facility was found to be installed. Testing will
   be conducted on the vector emulation facility.

   User Action: None.

VEC_FLOOVEMAT

floating overflow in the vector math library

   Facility: MTH, Mathematics Facility

   Explanation: At least one overflow condition occurred during the
   execution of a vectorized math routine. This message results from
   an incorrect call to the math library and usually indicates that
   an argument is too small or too large. The result returned is a
   reserved operand, minus zero.

   User Action: Locate where the program has used arguments that are
   out of range for the math routine in question.

VEC_FLOUNDMAT

floating underflow in the vector math library

   Facility: MTH, Mathematics Facility

   Explanation: At least one underflow condition was detected during
   the execution of a vectorized math procedure and the caller
   enabled for floating underflow traps. This message results from
   an incorrect call to the vectorized math library. Refer to the
   discussion of the LIB$FLT_UNDER procedure in the VMS Run-Time
   Library Routines Volume. The result returned is zero.

   User Action: Locate where the program has used arguments that are
   out of range for the math routine in question.

VECFULL

privileged vector limit of 42 exceeded

   Facility: SYSTEM, VMS System Services

   Explanation: This severe error message is associated with a status
   code returned from a system service request. The privileged vector
   limit of 42 is exceeded.

   User Action: Remove unnecessary vectors and relink.

VECINUSE

vector in use

   Facility: SYSGEN, System Generation Utility

   Explanation: The interrupt vector address that is specified in a
   SYSGEN command CONNECT is being used by another device.

   User Action: Change the vector address in the device driver and
   reenter the SYSGEN command CONNECT.

VEC_INVARGMAT

invalid vector argument to math library

   Facility: MTH, Mathematics Facility

   Explanation: One of the vector math procedures is called with an
   invalid argument. The result returned is a reserved operand, minus
   zero.

   User Action: Locate the vectorized math procedure call that caused
   the error and correct the argument.

VEC_LOGZERNEG

vectorized logarithm of zero or negative value

   Facility: MTH, Mathematics Facility

   Explanation: The vectorized LOG or DLOG math procedure is called
   with at least one zero or negative value. The result returned is a
   reserved operand, minus zero.

   User Action: Locate the call(s) to the vectorized procedure that
   caused the error(s), and correct the zero or negative argument(s).

VEC_SQUROONEG

vectorized square root of negative value(s)

   Facility: MTH, Mathematics Facility

   Explanation: A vectorized math procedure is called to evaluate the
   square root of at least one negative number. The result returned
   is a reserved operand, minus zero.

   User Action: Locate the call to the library procedure that
   returned the error. Correct the program so that all arguments
   are non-negative.

VECTOR

testing to be performed on xxx vector processors

   Facility: UETP, User Environment Test Package

   Explanation: The vector processor device test detected the
   presence of xxx vector processors installed and enabled on the
   host system

   User Action: None.

VEC_UNDEXP

undefined vector exponentiation

   Facility: MTH, Mathematics Facility

   Explanation: An expression contained at least one vector
   exponentiation that cannot be mathematically evaluated, for
   example, 0**0. The result returned is a reserved operand, minus
   zero.

   User Action: Locate the error in your vectorized program and
   correct the expression.

VER

error in version number

   Facility: RMS, VMS Record Management Services

   Explanation: The version number specified in a file specification
   contains invalid syntax, for example, nonnumeric characters or a
   value larger than 32,767.

   User Action: Correct the syntax of the file specification. Reenter
   the command or correct the program, as necessary.

VERBNOTFND

verb 'verb-name' not found in command tables

   Facility: CDU, Command Definition Utility

   Explanation: The verb you tried to delete is not defined in the
   CLD file.

   User Action: Ensure that the syntax is correct and try to delete
   the .CLD file again.

VERIFYERR

verification error for block 'n' of 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: During a compare or verify operation, the data in
   the specified block of the specified file did not agree with the
   input file. If other file activity is occurring on the volume, the
   error may result because another user modified the file during the
   back-up procedure.

   User Action: Note that the copies are inconsistent.

VERIFYICF

'opening/closing' command procedure 'filespec'

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger is verifying a command procedure. This
   message is displayed before the command procedure is executed
   and after all the commands have been displayed. This message is
   informational.

   User Action: None.

VERS_MISMATCH

version mismatch for log file format - operation aborted

   Facility: LMCP, Log Manager Control Program

   Explanation: The log header version is different from the one
   coded in LMCP.

   User Action: Check the definition of SYS$JOURNAL. If it is
   correct, submit a Software Performance Report (SPR) describing
   the conditions leading to the error and include a BACKUP save set
   containing the output of the DCL DUMP command for the log file.

VETO

resource manager refuses request to commit

   Facility: SYSTEM, VMS System Services

   Explanation: A resource manager refuses to commit the transaction.
   This is the result of an error in the user program.

   User Action: Determine why the resource manager could not commit a
   transaction and correct the error.

VFC

record too short to fill fixed part of VFC record

   Facility: CONVERT, Convert Utility

   Explanation: There are fewer bytes in the input record than are
   required for the fixed portion of the VFC output record.

   User Action: Either make the fixed control portion of the output
   record smaller, or do not use the /FIXED_CONTROL option.

Virtual Circuit Timeout

   Facility: VAXport, VAXport Driver

   Explanation: The VAXport driver closes the virtual circuit that
   the local CI port opened to the remote port. This closure occurs
   if the remote node is running CI Microcode Version 7 or higher,
   and the remote node failed to respond to any messages sent by the
   local node.

   User Action: This error is normal if the remote system halted,
   crashed, or is shut down. This error may mean the local node's
   PASTIMOUT SYSGEN parameter is set too low, especially if the
   remote node is running privileged user-written software.

'virtual-unit:' all shadow set copy operations are completed.

   Facility: Volume Processing Facility

   Explanation: All pending shadow set copy operations have
   completed; the same logical block on any shadow set member
   contains the same data.

   User Action: None.

'virtual-unit:' contains zero working members.

   Facility: Volume Processing Facility

   Explanation: The mount command cannot find a working member for
   the named shadow set. Subsequent messages name the shadow set
   members that are not operating. A system operator must restore
   one of the named shadow set members to operational status before
   MVTIMEOUT (SYSGEN parameter setting) expires; otherwise, mount
   aborts for the shadow set.

   User Action: None.

'virtual-unit:' shadow copy has been started.

   Facility: Volume Processing Facility

   Explanation: Indicates the start of a shadow copy operation.

   User Action: None.

'virtual-unit:' shadow set has changed state. Volume processing in progress.

   Facility: Volume Processing Facility

   Explanation: The state of the shadow set is in transition. The
   membership of the shadow may be increasing or decreasing.

   User Action: None.

VMB-F-Bootfile not contiguous

   Facility: VMB, Virtual Memory Boot

   Explanation: The file [SYSEXE]SYSBOOT.EXE is located but is not
   contiguous.

   User Action: The disk you are attempting to bootstrap cannot be
   bootstrapped. Obtain another copy of the system disk.

VMB-F-Failed to initialize device

   Facility: VMB, Virtual Memory Boot

   Explanation: Encountered an error in the load path while VMS was
   trying to initialize the boot device.

   User Action: Try initializing again. If this fails, call Field
   Service.

VMB-F-I/O error reading boot file

   Facility: VMB, Virtual Memory Boot

   Explanation: An uncorrectable read error occurred while the file
   [SYSEXE]SYSBOOT.EXE was being read.

   User Action: Try rebooting the disk. If subsequent attempts fail,
   obtain another copy of the system disk.

VMB-F-Nonexistent drive

   Facility: VMB, Virtual Memory Boot

   Explanation: The specified drive number does not exist.

   User Action: Specify an appropriate device unit to the console
   program, or use a different console bootstrap command procedure.

VMB-F-Unable to locate BOOT file

   Facility: VMB, Virtual Memory Boot

   Explanation: The file [SYSEXE]SYSBOOT.EXE could not be found.

   User Action: You are attempting to bootstrap a volume that does
   not contain a VMS binary system. Attempt to reboot using an
   appropriate disk volume.

VMB-F-Unexpected exception

   Facility: VMB, Virtual Memory Boot

   Explanation: An unexpected exception occurred while the primary
   bootstrap (VMB.EXE) was being executed. This condition probably
   indicates a corrupted SYSBOOT.EXE file or a hardware failure.

   User Action: Determine the source of the error, and either obtain
   a new copy of the system disk or call your DIGITAL field service
   representative.

VMB-F-Unexpected machine check

   Facility: VMB, Virtual Memory Boot

   Explanation: An unexpected machine check occurred while the
   primary bootstrap (VMB.EXE) was being executed. This condition
   probably indicates a corrupted SYSBOOT.EXE file or a hardware
   failure.

   User Action: Determine the source of the error, and either obtain
   a new copy of the system disk or call your DIGITAL field service
   representative.

VOIALREXI

voice-ID already exists for this device

   Facility: DTK, DECtalk Facility

   Explanation: A user tried to create a new voice identifier for
   a DECtalk device when one already exists. This is normal in a
   modular environment. The existing voice identifier is returned.

   User Action: None. Make sure you do not delete a voice identifier
   that you did not create.

VOLALRMNT

another volume of same label already mounted

   Facility: MOUNT, Mount Utility

   Explanation: Shared, group, and system volumes that are mounted
   concurrently must have unique volume labels. The request to mount
   a volume that has the same label as a volume already mounted
   failed.

   User Action: Mount the volume as a private volume, if it does not
   have to be shared; or wait until the conflicting volume has been
   dismounted. You can determine the status and ownership of the
   conflicting volume with the DCL command SHOW DEVICES/FULL/MOUNTED.

VOLIDENT

label = 'volume-label', owner = 'user-name', format = 'volume-
format'

   Facility: MOUNT, Mount Utility

   Explanation: This is an informational message that identifies an
   incorrectly specified volume after the INCVOLLABEL and NOHOMEBLK
   errors in a MOUNT request.

   User Action: None. This message is informational. If the volume
   protection allows access to the volume, reenter the DCL command
   MOUNT.

VOLINSET

'device-name' is already part of a volume set

   Facility: BACKUP, Backup Utility

   Explanation: The specified volume is already bound to a volume
   set. The volume cannot be used as a save set disk.

   User Action: Retry the operation using a properly initialized
   Files-11 Structure Level 2 volume.

volume is already part of another volume set

   Facility: MOUNT, Mount Utility

   Explanation: The volume specified in the DCL command MOUNT/BIND is
   part of another volume set.

   User Action: Check the device name specified. Either use another
   volume or initialize this one.


VOLINV

volume is not software enabled

   Facility: SYSTEM, VMS System Services

   Explanation: The volume valid bit is not set for the volume. All
   physical and logical I/O operations will be rejected until the bit
   is set.

   User Action: Check for a programming error. Verify that the volume
   is mounted and loaded. Check to see that the power is on before
   retrying the program.

VOLMOUNT

the volume 'volume-name' is already mounted

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility ignored a MOUNT command because
   the volume is already mounted.

   User Action: None.

VOLNAME

volume 'volume-name' in

   Facility: MOUNT, Mount Utility

   Explanation: This message is optionally issued with the MOUNTDEV
   message. It includes the volume name of the volume being mounted.

   User Action: None.

VOLOERR

must override owner identifier field in VOL1 label on 'device-name'

   Facility: MOUNT, Mount Utility

   Explanation: The owner identifier field of the VOL1 label must
   be overridden to allow access to the tape. The OWNER_ID option of
   the MOUNT/OVERRIDE command is used to interchange magnetic tapes
   between VMS and other DIGITAL operating systems.

   User Action: Reenter the MOUNT command and include the
   /OVERRIDE=OWNER_ID option.

VOLSETSTS

change of status for volume set 'volume-set-name'

   Facility: MOUNT, Mount Utility

   Explanation: MOUNT encountered a condition that resulted in
   a change of state for the specified volume set. Accompanying
   messages describe the nature of the change.

   User Action: Take corrective action based on the accompanying
   messages.

VOLSHDWMEM

mounting a shadow set member volume; volume write locked

   Facility: MOUNT, Mount Utility

   Explanation: This informational message indicates that the volume
   being mounted is a former shadow set member. To prevent accidental
   destruction of data, this volume is being mounted write-locked.

   User Action: To allow write access to this volume, dismount
   the volume and remount it with the /OVERRIDE=SHADOW_MEMBERSHIP
   qualifier.

VOLSTATUS

change of status for volume 'volume-name'

   Facility: MOUNT, Mount Utility

   Explanation: MOUNT encountered a condition that resulted in a
   change of state for the specified volume. Accompanying messages
   describe the nature of the change.

   User Action: Take corrective action based on the accompanying
   messages.

VOLUME_FULL

volume is full (insufficient space for the request)

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility is unable to copy a file because
   the volume had insufficient space.

   User Action: RT-11 only supports contiguous files, therefore there
   must be a free space on the volume as large as the file you are
   trying to copy. Use the DIRECTORY /ALL command to see where the
   unused areas on the volume are. By deleting unneeded files which
   are adjacent to unused areas it, might be possible to create a
   large enough space. Also, if you use the COPY command to copy a
   file to the same volume, you can move files around and make larger
   free areas.

WACKQEMPTY

NETACP-ack wait queue empty

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WAITERR

error waiting for RMS operation to complete

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an error while
   waiting for RMS.

   User Action: This is only possible if EXCHANGE is interrupted
   by a CTRL/Y. Repeat the command and let it complete without
   interruption.

WAITIDLEBCB

attempted wait on idle buffer

   Facility: BACKUP, Backup Utility

   Explanation: A software error occurred in the Backup Utility.

   User Action: Submit a Software Performance Report (SPR).

WANTOSEND

do you want to send anyway (Y/N, default is N)?

   Facility: MAIL, Mail Utility

   Explanation: One or more of the addresses were unavailable.

   User Action: Type Y if you want to send your message to the
   available addresses.

WARNING

parsed with warnings

   Facility: FDL, Create/FDL Utility

   Explanation: This message accompanies the other warning-level
   messages.

   User Action: The FDL file parsed successfully; you may either
   correct the cause of the warning or continue.

WARNISUE

completed with warnings

   Facility: LINK, Linker Utility

   Explanation: The link completed, but warnings were issued.

   User Action: None.

WASECC

successful transfer; no data check

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with a status code
   returned by I/O functions. A data check operation is not
   performed. The function is a read operation that is completed
   successfully by applying one or more ECC corrections. The
   specified data check, however, is not performed.

   User Action: Note the condition. Modify the source program, if
   necessary, to detect and respond to the condition.

WBE

error on write behind

   Facility: RMS, VMS Record Management Services

   Explanation: An error occurred during a VMS RMS operation for
   which write behind is specified.

   User Action: The status value (STV) field of the RAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.

WCBFCBMNG

WCB/FCB correspondence broken

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WCC

invalid wildcard context (WCC) value

   Facility: RMS, VMS Record Management Services

   Explanation: The wildcard context value in the NAM block (an input
   file-processing option) contains an invalid value.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly and that the NAM block is not inadvertently modified
   between VMS RMS service calls.

WCSCORR

WCS error correction failed

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WDW_MAXPREV

too many previous records in window

   Facility: SEARCH, SEARCH Command

   Explanation: SEARCH could not create enough buffer space to hold
   all the records in a window. Only records before the match are
   significant; SEARCH does not need to store records that follow the
   match.

   User Action: Specify a smaller window, or ask your system manager
   to have your paging file quota increased.

WDW_MAXPRM

too many window parameters

   Facility: SEARCH, SEARCH Command

   Explanation: The /WINDOW parameter is not specified correctly.

   User Action: Reenter the command using the correct syntax.

WER

file write error

   Facility: RMS, VMS Record Management Services

   Explanation: An error occurred during a VMS RMS write operation.

   User Action: The status value (STV) field of the RAB contains
   a system status code that provides more information about the
   condition. Take corrective action based on this status code.

WFR

.RESTORE not in same file as .SAVE/.SAVEALL: "additional locational
information"

   Facility: RUNOFF, DIGITAL Standard Runoff

   Explanation: You cannot issue a .RESTORE directive for a .SAVE
   directive from within a require file if that .SAVE directive
   occurred in a higher level file or another require file.

   User Action: Change the order of directives so that the .REQUIRE
   directive is issued between the .SAVE and .RESTORE directives.

WIDMISMATCH

parameter 'numbers' class, 'class', unsupported

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The wrong type of widget has been passed to a VAXTPU
   built-in procedure. Usually, the procedure can only accept a
   simple text widget.

   User Action: Correct your code and try again.

WILDCONCAT

wildcard specification cannot be concatenated

   Facility: Shared by several facilities

   Explanation: A number of files to be concatenated cannot be
   specified with wild cards.

   User Action: Respecify the files without using wildcards.

WILDOVTVER

wildcard version required for output file

   Facility: Shared by several facilities

   Explanation: A wildcard version must be specified on an output
   file.

   User Action: Correct the command specifying the wildcard version.

WILUSERMS

output will be performed by RMS later

   Facility: SMG, Screen Management Facility

   Explanation: Normally, the screen is updated at the end of every
   output operation. If, however, the 'device-name' is actually a
   file or an unknown terminal, then this message is given at the
   time output would have been sent to the screen.

   User Action: Use the SMG$SNAPSHOT routine to receive your output.

WINDNOTMAPPED

the window is not mapped to a buffer

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: You attempted to manipulate a window that is not on
   the screen.

   User Action: Use the built-in procedure MAP to associate the
   window with a buffer on the screen.

WINDNOTVIS

built-in procedure cannot operate on an invisible window

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The built-in procedure that you are attempting to use
   (for example, POSITION) can only use visible windows. The window
   that you used as an argument is not visible because it is occluded
   by other windows.

   User Action: Remap the window to the screen to make it visible
   again.

WINEXISTS

a viewport has already been associated with the display

   Facility: SMG, Screen Management Facility

   Explanation: A viewport exists. That is, a viewport has already
   been associated with the virtual display.

   User Action: Follow these steps:

   1. Use the viewport that is already associated with the virtual
      display.

   2. Delete the existing viewport before you create the new
      viewport.

   3. Use other viewport routines to change or move the existing
      viewport.

WINK

a wink is detected on the phone line

   Facility: DTK, DECtalk Facility

   Explanation: A wink (a possible timeout) is detected on the phone
   line. The caller may have hung up the phone.

   User Action: None.

WINTRUNCFIT

viewport truncated to fit

   Facility: SMG, Screen Management Facility

   Explanation: The viewport specification will not completely fit
   within the virtual display. The viewport is truncated to fit
   within the virtual display.

   User Action: None.

WKQERR

work queue management routine error

   Facility: EVL, Event Logger

   Explanation: One of the work queue management routines returned
   an error. This indicates a software error or a VMS system
   configuration problem.

   User Action: Check the maximum virtual memory allowed for the
   process and the timer element quota. There should be one timer
   element for each sink node in use, plus two.

WLD

invalid wildcard operation

   Facility: RMS, VMS Record Management Services

   Explanation: A call to one of the VMS RMS services $CREATE,
   $ERASE, $ENTER, $OPEN, and $RENAME specified a wildcard in one or
   more components of a file specification. No wildcards are allowed
   in these services.

   User Action: Correct the source program. Verify that the call
   to VMS RMS is coded correctly. To perform a wildcard file delete
   service, you must code a loop that searches for files based on
   wildcard specifications and deletes the files individually.

WLDNOTALWD

wildcard user specs not allowed

   Facility: AUTHORIZE, Authorize Utility

   Explanation: Wildcard characters are not allowed in the user
   specification for the command you are using.

   User Action: Reenter your command without using wildcard
   characters.

WLK

device currently write locked

   Facility: RMS, VMS Record Management Services

   Explanation: The hardware device specified for a VMS RMS operation
   is write-locked for protection, and write-access is attempted.

   User Action: Verify the status of the hardware device; reset the
   write-lock switch, if necessary. Notify the system operator if the
   error cannot be corrected.

Work file failed to close

   Facility: EDT, EDT Editor

   Explanation: EDT is unable to close its work file.

   User Action: After determining the reason why EDT cannot close its
   work file, correct the problem.

Work file failed to open

   Facility: EDT, EDT Editor

   Explanation: EDT is unable to open its work file.

   User Action: After determining the reason why EDT cannot open its
   work file, correct the problem.

Work file overflow

   Facility: EDT, EDT Editor

   Explanation: You exceeded EDT's limit on the size of its work
   file. The limit is 65,535 blocks.

   User Action: Use the CLEAR command to delete a buffer when it is
   no longer needed. This precaution will also help to reduce the
   size of the work file on systems with small disks.

WORK_DEV

work file 'filespec' must be on random access local device

   Facility: SORT, Sort/Merge Utility

   Explanation: Work files must be specified for random access
   devices that are local to the CPU on which the sort is being
   performed (that is, not on node in a network). Random access
   devices are disk devices.

   User Action: Specify the correct device.

Working

   Facility: EDT, EDT Editor

   Explanation: This message is displayed when the command operation
   requires more than a minimum amount of time to complete. EDT is
   responding to your command.

   User Action: None.

WORKSTACMD

the command 'DEBUG-command' is only supported on workstations

   Facility: DEBUG, VMS Debugger

   Explanation: The debugger supports the command 'DEBUG-command'
   only on workstations. This feature of the debugger is not
   available for your terminal or machine.

   User Action: None.

WPL

error detected while writing prolog

   Facility: RMS, VMS Record Management Services

   Explanation: An I/O error occurred while VMS RMS is writing a
   file's prolog area.

   User Action: Depending on the operation, the status value
   (STV) field in the FAB or RAB contains a system status code
   that provides additional information about the condition. Take
   corrective action based on this status code.

WPTTRACE

nonstatic watchpoint, tracing every instruction

   Facility: DEBUG, VMS Debugger

   Explanation: Setting a watchpoint on a nonstatic location, such
   as the stack or on a register, forces the debugger to trace every
   instruction that is executed. This slows down execution of your
   program considerably.

   User Action: If you do not want execution of your program to slow
   down, then you must cancel the watchpoint.

WRIRSPMSG

error writing system service response message

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error responding
   to a $GETQUI, $SNDACC, $SNDJBC, or $SNDSMB system service. The
   accompanying message provides additional information.

   User Action: Take action based on the accompanying message.

WRISMBMBX

error writing symbiont mailbox

   Facility: JBC, Job Controller

   Explanation: The job controller encountered an error communicating
   with a symbiont process. The accompanying message provides
   additional information.

   User Action: Take action based on the accompanying message.

Write file could not be closed

   Facility: EDT, EDT Editor

   Explanation: EDT opened the output file and copied the text
   specified with the WRITE command into that file. However, for
   some reason at the system level, EDT cannot close that file.

   User Action: Correct the problem indicated by the accompanying
   message.

Write file could not be created

   Facility: EDT, EDT Editor

   Explanation: EDT could not create the output file with the file
   specification you supplied with the WRITE command. This error can
   be caused by problems in the file name itself (either it has too
   many characters or an invalid character). Other causes include
   problems in the directory specification, if you used one (either
   the directory does not exist, you do not have access to it, or the
   directory specification format is incorrect). This message could
   also mean that there is a problem with the file system, such as
   insufficient disk space.

   User Action: After determining the cause of the problem, correct
   it.

WRITEACT

ACTIVE system parameters modified by process ID 'pid'

   Facility: SYSGEN, System Generation Utility

   Explanation: This message is written to the operator's console
   when a WRITE ACTIVE operation is done from SYSGEN. This message is
   a monitoring aid for the system manager.

   User Action: None.

WRITEATTR

error writing attributes for 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to write the file attributes of the specified file. The
   accompanying message provides additional information.

   User Action: Correct the condition that caused the error and
   reenter the command.

WRITEBACK

error writing backup date for 'device-name' file ID ('file-id')

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to update the back-up date of the specified file. The
   accompanying message provides additional information. If other
   file activity is occurring on the volume, the error is probably
   caused because another user deleted the file during the back-up
   procedure.

   User Action: If necessary, correct the condition that caused the
   error and reenter the command.

WRITEBLOCK

error writing block 'n' of 'filespec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered an error during an
   attempt to write the specified block of the specified file. The
   accompanying message provides additional information.

   User Action: Examine the file for corruption; reconstruct the file
   as necessary.

WRITEBOOT

error writing boot block, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Analyze/Disk_Structure Utility encountered an
   error during an attempt to write a dummy bootstrap block to
   virtual block 1 of the index file [000000]INDEXF.SYS;1 on the
   specified relative volume. The accompanying message provides
   additional information.

   User Action: The specified volume probably cannot be used as a
   system volume for a VAX-11 processor model that requires access to
   the bootstrap block during a bootstrap operation.

WRITECHECK

write error detected during check on volume 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility received an error while checking
   a write operation.

   User Action: The media has bad areas and should probably be
   discarded or reformatted.

WRITECHECKREC

write check error recovered on volume 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an error while
   checking a write on the volume, but the operation succeeded on
   a retry.

   User Action: The file is written successfully, but the user should
   watch the volume for further signs of deterioration. Discard or
   reformat the volume if errors are frequent.

WRITECUR

CURRENT system parameters modified by process ID 'pid' into file
'filespec'

   Facility: SYSGEN, System Generation Utility

   Explanation: This message is written to the operator's console
   when a WRITE CURRENT operation is done from SYSGEN. This message
   is a monitoring aid for the system manager.

   User Action: None.

WRITEERR

error while writing output

   Facility: ACCOUNTING, Accounting Utility

   Explanation: During a VMS RMS operation, an error is encountered
   while writing a file. Filespec is the file specification of the
   file being written.

   User Action: Determine that the file is open and that you have
   write privilege. If the error is reproducible, notify your system
   manager.

error writing 'output-filespec'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An output file cannot be written. The message should
   be accompanied by RMS messages indicating the reason for failure.

   User Action: Take action based on the accompanying RMS message.

error writing 'filespec'

   Facility: Shared by several facilities

   Explanation: During a VMS RMS operation, an error is encountered
   while writing a file.

   If this error occurred during a macro assembly operation,
   the assembler encountered an I/O error when writing to the
   output object module or listing file; 'filespec' is the file
   specification of the file being written.

   User Action: Determine that the file is open and that you have
   write privilege. If this is a macro assembly error, retry the
   assembly. If the error is reproducible, notify your system
   manager.

error writing 'filename'

   Facility: SET, SET Facility

   Explanation: A problem has occurred while writing to a file or a
   directory.

   User Action: Take corrective action based on the accompanying
   message.

error writing 'output-filespec'

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: The output file cannot be written. This message
   should be accompanied by a VMS RMS message indicating the reason
   for the error.

   User Action: Follow the recovery procedure for the specified VMS
   RMS message.

error writing library

   Facility: LBR, Librarian Subroutine Package

   Explanation: An error occurred while writing the cached disk
   blocks of the library file.

   User Action: If the resulting library file is corrupt, submit a
   Software Performance Report (SPR).



WRITE_ERR

error writing 'filespec'

   Facility: CONVERT, Convert Utility, CONVERT, Convert/Reclaim
   Utility

   Explanation: This message will be accompanied by an RMS error
   message that explains the error.

   User Action: Correct the error described in the RMS error message
   and try again.




WRITEERRREC

write error recovered on volume 'volume-name'

   Facility: EXCHANGE, Exchange Utility

   Explanation: The Exchange Utility encountered an error while
   writing the volume, but the operation succeeded on a retry.

   User Action: The file is written successfully, but the user should
   watch the volume for further signs of deterioration. Discard or
   reformat the volume if errors are frequent.

WRITE_FAILED

an attempt to write into a memory location failed

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).

WRITEFILE

error writing event file 'file-id'

   Facility: EVL, Event Logger

   Explanation: An error occurred while writing an event record to a
   file. All events destined for that sink will be discarded. This
   message displays the file name.

   User Action: Take corrective action based on the accompanying
   message.

WRITEHEADER

file ('file-id') 'filename' file header write error

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to write the specified file header to the index file,
   [000000]INDEXF.SYS;1, on the specified relative volume. The
   accompanying message provides additional information.

   User Action: If the specified file header is currently in use, the
   file can no longer be accessed by the operating system. It must be
   deleted and reconstructed from back-up media. If the file header
   is not in use, no action is necessary because the operating system
   will not attempt to use the file header.

WRITEHOME

error writing home block, VBN 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to write the home block to the specified virtual block of
   the index file, [000000]INDEXF.SYS;1, on the specified relative
   volume. The accompanying message provides additional information.

   User Action: The volume probably can be mounted by the operating
   system using one of the alternate home blocks, but the user should
   consider copying the volume to fresh media.

WRITEIBMAP

error writing index file bitmap, VBN 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to write the index file bit map to the specified virtual
   block of the index file, [000000]INDEXF.SYS;1, on the specified
   relative volume. The accompanying message provides additional
   information.

   User Action: The volume probably can be mounted by the operating
   system, but you should copy the volume to fresh media or
   reconstruct the volume from back-up media.

WRITE_INTO_KERNEL

cannot write into the kernel debugger's address space

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).

WRITE_INTO_KERNEL_STACK

cannot write into the kernel debugger's stack

   Facility: DEBUG, VMS Debugger

   Explanation: This message indicates an internal debugger error.

   User Action: Submit a Software Performance Report (SPR).

WRITEJNLACE

error writing journal ACE for 'filespec' file ID 'file-id'

   Facility: BACKUP, Backup Utility

   Explanation: BACKUP could not write out the journal Access Control
   Entry for the specified file.

   User Action: Determine why the ACL could not be written. This
   could be due to a corrupted ACL or some other hardware or software
   related error. Correct the problem if possible and retry the
   BACKUP operation.

WRITELOCK

volume is write locked

   Facility: MOUNT, Mount Utility

   Explanation: This informational message indicates that the DCL
   command MOUNT found the volume to be write-locked.

   User Action: None, unless you wish to write on the volume. In that
   case, you must write-enable the drive, and dismount and mount the
   volume.

WRITEMON

error writing event to monitor process 'sink-name'

   Facility: EVL, Event Logger

   Explanation: An error occurred while writing an event record to
   a monitor program. The link will be reestablished to the monitor
   process. This message displays the name of the monitor program.

   User Action: Take corrective action based on the accompanying
   message.

WRITENABLE

write enable volume 'n' on 'device-name'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility requires that the specified volume
   of an output save set be write-enabled.

   User Action: Note that the Backup Utility will write on the
   volume, ensure that a suitable volume has been mounted, and write-
   enable the volume. If the utility is executing as an interactive
   job, reply "YES" to the prompt on SYS$COMMAND. If the utility
   is executing as a batch job, use the DCL command REPLY to signal
   completion.

WRITERRS

excessive error rate writing 'save-set-spec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility encountered numerous write
   errors in the specified save set. The save set medium is probably
   unusable.

   User Action: Retire the save set medium.

WRITESBMAP

error writing storage bitmap, VBN 'n', RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to write the storage bit map to the specified virtual
   block of the storage bit map file, [000000]BITMAP.SYS;1, on the
   specified relative volume. The accompanying message provides
   additional information.

   User Action: The volume probably can be mounted by the operating
   system, but you should copy the volume to fresh media or
   reconstruct the volume from back-up media.

WRITESCB

error writing storage control block, RVN 'n'

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility encountered an error during an
   attempt to write the storage control block to virtual block 1 of
   the storage bit map file, [000000]BITMAP.SYS;1 on the specified
   relative volume. The accompanying message provides additional
   information.

   User Action: The volume probably can be mounted by the operating
   system, but the user should copy the volume to fresh media or
   reconstruct the volume from back-up media.

write error on storage control block; volume is write locked

   Facility: MOUNT, Mount Utility

   Explanation: An I/O error occurred while the volume is being
   mounted; the volume has been write-locked to protect its
   integrity.

   User Action: Check the hardware and retry the program.


WRITLCK

volume on 'device-name' is write locked write lock error

   Facility: SYSTEM, VMS System Services

   Explanation: The volume cannot be written because the hardware
   write-lock switch is set on the drive or the device is software
   write-locked.

   User Action: Release the write-lock switch and retry the program.

WRNERS

compilation warnings in module 'module-name' file 'filename'

   Facility: LINK, Linker Utility

   Explanation: The specified module has compilation warnings.

   User Action: Correct the module and relink.

WRONGACMODE

operation attempted from insufficiently privileged access mode

   Facility: SYSTEM, VMS System Services

   Explanation: The process had insufficient privileges to execute
   the requested operations. This is an error in the user program.

   User Action: Correct the error in the program.

WRONGACP

wrong ACP for device

   Facility: SYSTEM, VMS System Services

   Explanation: This message is associated with a status code
   returned from the IO$_MOUNT ACP QIO function. The ACP specified is
   the wrong one for the file structure being mounted.

   User Action: Check the ACP specified in the DCL command MOUNT
   /PROCESSOR; verify what structure you are trying to mount.

WRONGDATASET

records could not be found in the data set

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: An internal error occurred in the VAXTPU software.

   User Action: Submit a Software Performance Report (SPR).

WRONGOWNER

file ('file-id') 'filename' inconsistent extension file header owner
UIC

   Facility: ANALDISK, Analyze/Disk_Structure Utility

   Explanation: The Verify Utility found that the file owner UIC
   recorded in an extension file header for the specified file did
   not agree with that recorded in the primary header.

   User Action: Verify corrects the extension file header.

WRONGSTATE

invalid transaction state for requested event

   Facility: SYSTEM, VMS System Services

   Explanation: The transaction is in the wrong state for the
   attempted operation. This is an error in the user program.

   User Action: Correct the error in the program.

WRONGVOL

'date and time', Device 'device-name' contains the wrong volume.
Mount verification in progress

   Facility: OPCOM, Operator Communication

   Explanation: The volume in the drive is not the original volume.

   User Action: Replace the original volume in the drive and cancel
   the mount verification.

device 'device-name' contains the wrong volume

   Facility: MOUNT, Mount Utility

   Explanation: The specified volume does not match the volume in the
   drive.

   User Action: Correct the volume name and retry the operation.

'save-set-spec' is not the next volume in the set

   Facility: BACKUP, Backup Utility

   Explanation: The volume mounted as a continuation volume of a
   multivolume save set is not the successor of the previous volume
   of the save set. Volumes must be processed in the order of their
   creation.

   User Action: Locate and mount the correct continuation volume.



WRONUMARG

wrong number of arguments

   Facility: PPL, Parallel Processing Facility

   Explanation: Too many or too few arguments are specified in the
   call.

   User Action: Recode the program using the correct number of
   arguments.

wrong number of arguments

   Facility: DTK, DECtalk Facility

   Explanation: A DTK$ routine is called with too many or too few
   arguments.

   User Action: Change the code to call the routine with the correct
   number of arguments.

wrong number of arguments

   Facility: Shared by several facilities

   Explanation: An STR$ routine is called with an incorrect number of
   arguments.

   User Action: Check the argument list in the call. High-level
   language programmers who have not issued a call directly to an
   STR$ routine should submit a Software Performance Report with
   supporting documentation, including the system traceback listing.

wrong number of arguments

   Facility: SMG, Screen Management Facility

   Explanation: An SMG routine is called with less than the number of
   required arguments or too many arguments.

   User Action: Correct the code to call the routine with the proper
   number of arguments.

wrong number of arguments

   Facility: STR, String Manipulation Facility

   Explanation: A String Facility entry is called with an incorrect
   number of arguments.

   User Action: A user who calls the String Facility directly
   should check the argument list in the call. High-level language
   programmers who have not issued a call directly to a String
   Facility routine should submit a Software Performance Report with
   supporting documentation, including the system traceback listing.





WRTEVT

error writing events to sink node receiver

   Facility: EVL, Event Logger

   Explanation: An error occurred while writing information over a
   logical link to an event receiver. The link will be reopened and
   the operation will be retried. This error may be due to a VMS
   system or network configuration problem.

   User Action: Take corrective action based on the accompanying
   message.

WRTFIL

updating image file 'filespec'

   Facility: PATCH, Patch Utility

   Explanation: The specified image file is updated to include the
   previous patch.

   User Action: None.

WRTHOMBLK

I/O error writing home block

   Facility: MOUNT, Mount Utility

   Explanation: An I/O error occurred writing the home block of a
   volume during the MOUNT/BIND operation.

   User Action: Check that the hardware is functioning properly.
   Reinitialize the disks and retry the operation.

WRTINVBUF

ACP attempted to write an invalid buffer

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WRTINVHDR

ACP attempted to write an invalid file header

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WRTPGSBAK

write pages back-inconsistent database

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WS default and quota raised to PHD +MINWSCNT

   Facility: SYSBOOT, System Bootstrap Facility

   Explanation: The default size of the working set has been
   increased to equal the sum of the working set count (which is
   the count of fluid working set pages), plus the process header.

   User Action: None.

WSLENOVAL

working set list entry not valid

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WSLPAGCNT

working set list page count error

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WSLVANVAL

working set list virtual adr has nonvalid PTE

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WSLXVANMAT

working set list entry does not match VA

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

WSSIZEERR

working set size less than pages in use

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

XAB

invalid XAB or XAB not accessible at location

   Facility: RMS, VMS Record Management Services

   Explanation: The XAB specified in the XAB field of the FAB, or in
   the NXT field of another XAB, pointed to an XAB that either is not
   writeable by the caller or contains an invalid block length field.

   User Action: The status value (STV) field of the FAB provides the
   address of the XAB in error. Verify that the call to the VMS RMS
   service is coded correctly.

XNF

required XAB not found

   Facility: RMS, VMS Record Management Services

   Explanation: A VMS RMS request required an XAB which is not
   specified. For example, the ROP option, ETO is specified, but
   no EABTRM is supplied.

   User Action: Verify that the call to the VMS RMS service is coded
   correctly.

XORERRS

'n' errors recovered by redundancy group in 'save-set-spec'

   Facility: BACKUP, Backup Utility

   Explanation: The Backup Utility successfully recovered from
   uncorrectable read errors in the specified save set the specified
   number of times by using the redundancy information.

   User Action: None. However, if the number of errors appears
   excessive, consider retiring the save set medium at a convenient
   time.

XQPERR

Error detected by file system XQP

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

YES

yes

   Facility: VAXTPU, VAX Text Processing Utility

   Explanation: Prototype affirmative response.

   User Action: None.

YESNO

please enter YES or NO.

   Facility: VMSINSTAL, Install Procedures

   Explanation: VMSINSTAL asked a question that must be answered YES
   or NO.

   User Action: Answer the question again, specifying YES or NO. You
   may abbreviate these answers as Y or N, respectively.

ZEROLEN

zero length record encountered, entry 'n' skipped

   Facility: ERF, Error Log Utility

   Explanation: A null entry was encountered.

   User Action: Submit a Software Performance Report (SPR).

ZEROPAGE

Zero page table entry from swap map

   Facility: BUGCHECK, System Bugcheck

   Explanation: The VMS software detected an irrecoverable,
   inconsistent condition. After all of physical memory is written to
   a system dump file, the system will automatically reboot if the
   BUGREBOOT system parameter is set to 1.

   User Action: Submit a Software Performance Report (SPR) that
   describes the conditions leading to the error. Include a BACKUP
   save set containing the system dump file and the error log file
   active at the time of the error. (Use the /IGNORE=NOBACKUP
   qualifier with the BACKUP command that produces the save set
   included with the SPR.)

Typewritten Software • bear@typewritten.org • Edmonds, WA 98026